ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0175 (HSP101, ClpB2)

heat shock protein 101, a gene from Plasmodium falciparum

Compiled localisation
parasitophorous vacuole membrane during ring and schizont and trophozoite
intracellular vacuole membrane during schizont
parasitophorous vacuole

Who localised this protein by microscopy?

El Bakkouri, M., Pow, A., Mulichak, A., Cheung, K. L., Artz, J. D., Amani, M., Fell, S., de Koning-Ward, T. F., Goodman, C. D., McFadden, G. I., Ortega, J., Hui, R., Houry, W. A.
The Clp chaperones and proteases of the human malaria parasite Plasmodium falciparum. (2010 Dec 3, J Mol Biol) PubMed / full text
   more detail about this publication

parasitophorous vacuole

de Koning-Ward, T. F., Gilson, P. R., Boddey, J. A., Rug, M., Smith, B. J., Papenfuss, A. T., Sanders, P. R., Lundie, R. J., Maier, A. G., Cowman, A. F., Crabb, B. S.
A newly discovered protein export machine in malaria parasites. (2009 Jun 18, Nature) PubMed / full text
   more detail about this publication

parasitophorous vacuole membrane during ring and schizont and trophozoite, intracellular vacuole membrane during schizont
  • "Immunofluorescence analysis (IFA) showed that PTEX150 and HSP101 co-localize and are found in discrete foci in the membranes surrounding the ring-stage parasite (Fig. 1d). This membrane is the PVM, as fluorescence surrounds the parasite membrane marker MSP1(19). "
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein, HA tag
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: PVM during ring and troph and schizont, intracellular vacuole membrane during schizont
  • Other genes localised in this publication: translocon component PTEX150, merozoite surface protein 1, exported protein 2

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10114

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF11_0175 heat shock protein 101
MTRRYLKYYIFVTLLFFVQVINNVLCAPDNKQEQGKYLNRTINILNAGKNIAKSYGHNKLKPIHILSALAKSDYGSTLFK
ENNVNAANLKEYIDIALEQTRAGAPLDNKSKIVNSAEVKETLALAEAAANKYKSPKVDVEHLLSGLSNDELVNEIFNEVY
LTDEAIKAILKRKFEKTKKDKDGKTGTLYIEQFGSNMNEKVRNGKLQGIYGRDEEIRAIIESLLRYNKNSPVLVGNPGTG
KTTIVEGLVYRIEKGDVPKELQGYTVISLNFRKFTSGTSYRGEFETRMKNIIKELKNKKNKIILFVDEIHLLLGAGKAEG
GTDAANLLKPVLSKGEIKLIGATTIAEYRKFIESCSAFERRFEKILVEPPSVDMTVKILRSLKSKYENFYGINITDKALV
AAAKISDRFIKDRYLPDKAIDLLNKACSFLQVQLSGKPRIIDVTERDIERLSYEISTLEKDVDKVSKKKYNKLIKEFEEK
KEQLKKYYEEYVITGERLKRKKEIEKKLNDLKELTQNYVYSNKEPPIELQNSLKEAQQKYLELYKETVAYVEAKTHNAMN
VDAVYQEHVSYIYLRDSGMPLGSLSFESSKGALKLYNSLSKSIIGNEDIIKSLSDAVVKAATGMKDPEKPIGTFLFLGPT
GVGKTELAKTLAIELFNSKDNLIRVNMSEFTEAHSVSKITGSPPGYVGFSDSGQLTEAVREKPHSVVLFDELEKAHADVF
KVLLQILGDGYINDNHRRNIDFSNTIIIMTSNLGAELFKKKLFFDADNSGTPEYKRVMEDVRLSLIKKCKKVFKPEFVNR
IDKIGVFEPLNKKNLHKIVALRFKKLEKRLEEKNIQVSVSEKAIDYIIDQSYDPELGARPTLIFIESVIMTKFAIMYLKK
ELVDDMDVFVDYNSKAKNLVINLSKT

Gene-Specific Links for PF11_0175

General Sub-Cellular Localisation Links