ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0174 (DPAP1)

cathepsin C, homolog,dipeptidyl peptidase 1, a gene from Plasmodium falciparum

Compiled localisation
food vacuole and parasitophorous vacuole during schizont and trophozoite

Who localised this protein by microscopy?

Klemba, M., Gluzman, I., Goldberg, D. E.
A Plasmodium falciparum dipeptidyl aminopeptidase I participates in vacuolar hemoglobin degradation. (2004 Oct 8, J Biol Chem) PubMed / full text
   more detail about this publication

food vacuole and parasitophorous vacuole during schizont and trophozoite
  • "No GFP fluorescence was observed in ring-stage parasites (data not shown). In trophozoites and schizonts, accumulation of GFP in the food vacuole provided the first evidence that DPAP1 resides in this compartment (Fig. 4, AD). To confirm that DPAP1 was transported to the food vacuole along with GFP, DPAP1 was localized by cryo-immunoelectron microscopy in F9 parasites. Immunogold label was abundant in the food vacuole, with occasional labeling outside of the food vacuole that may be associated with proDPAP1 in transit to the food vacuole (Fig. 4E). "
  • Microscopy type: Light, EM
  • Microscopy method: GFP, polyclonal antibody directly to protein against epitope TKKLDRKYLNNFDD
  • Strain: F9
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: FV and PV during troph and schizont
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13781

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF11_0174 cathepsin C, homolog,dipeptidyl peptidase 1
MAKRIFSVSFLLVLLNVLHICIKFSVADLPTHVETKNLLGKWKILRTKTSPNLTTCGSSQPNKNTYNVGITDYKKYLLEN
NYEFVSELNVILSDDYVLYGDIYNTQDNEHRSKWKVLAVYDENKRVIGTWTTICDEGFEIKIGNETYAALMHYEPNGKCG
PVSDEDSLDSNGDTDCYTTSFSKIRYGWLDVENEKNEHLHGCFYAERIFDNVNEIKHLDSFTIDKDSQNVLQTFTYDTKL
NNILNSNNMLYKFGNLQKPTFTKRNNTNVQFNSELNWHRMKHHGKKKPLKKSMLDASRQTYACPCNANEVVDNVINKGDS
DNPVSPTLIQLNNNLKNTTQTGNKDTNEMDLENYEDTLNSPKRELEINELPKNFTWGDPWNKNTREYEVTNQLLCGSCYI
ASQLYAFKRRIEVALTKKLDRKYLNNFDDQLSIQTVLSCSFYDQGCNGGFPYLVSKLAKLQGIPLNVYFPYSATEETCPY
NISKHPNDMNGSAKLREINAIFNSNNNMSTYNNINNDHHQLGVYANTASSQEQHGISEENRWYAKDFNYVGGCYGCNQCN
GEKIMMNEIYRNGPIVSSFEASPDFYDYADGVYFVEDFPHARRCTIEPKNDGVYNITGWDRVNHAIVLLGWGEEEINGKL
YKYWIGRNSWGNGWGKEGYFKILRGQNFSGIESQSLFIEPDFSRGAGKILLEKMQKELGN

Gene-Specific Links for PF11_0174

General Sub-Cellular Localisation Links