ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0165 (Falcipain-2, FP2)

cysteine proteinase falcipain 2a, a gene from Plasmodium falciparum

Compiled localisation
cytoplasmic vesicle and endoplasmic reticulum and golgi apparatus during trophozoite
food vacuole during early schizont and early trophozoite and late schizont and late trophozoite and trophozoite
during not early ring and not late ring

Who localised this protein by microscopy?

Dasaradhi, P. V., Korde, R., Thompson, J. K., Tanwar, C., Nag, T. C., Chauhan, V. S., Cowman, A. F., Mohmmed, A., Malhotra, P.
Food vacuole targeting and trafficking of falcipain-2, an important cysteine protease of human malaria parasite Plasmodium falciparum. (2007 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytoplasmic vesicle and endoplasmic reticulum and food vacuole and golgi apparatus during trophozoite
  • "We also observed GFP-Fal2 chimeras packaged into small membrane bound compartments, cytostomal vesicles or foci. Some of these foci appeared to be connected to PV and food vacuole, while many of them appeared as independent vesicles in the parasite cytosol."
  • Microscopy type: Light, EM
  • Microscopy method: GFP tag, polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER and golgi and cytoplasmic vesicles and Food Vacuole during trophozoite
  • Comment: strain information not found
  • Comment: different GFP fusions gave slightly different localisations
  • Other genes localised in this publication: -

Subramanian, S., Sijwali, P. S., Rosenthal, P. J.
Falcipain cysteine proteases require bipartite motifs for trafficking to the Plasmodium falciparum food vacuole. (2007 Aug 24, J Biol Chem) PubMed / full text
   more detail about this publication

food vacuole during early trophozoite and trophozoite
  • "GFP fusion proteins were targeted to the food vacuoles of young trophozoites, as evidenced by co-localization with hemozoin, a breakdown product of hemoglobin in this compartment, when visualized using confocal microscopy (Fig. 1, b and c)."
  • Microscopy type: Light
  • Microscopy method: GFP, antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: FV during young troph
  • Other genes localised in this publication: cysteine proteinase falcipain 3, chloroquine resistance transporter
  • "Immunoelectron microscopy confirmed co-localization of proFP2-GFP (15-nm gold particles) and native falcipain-2 (10-nm gold particles) in the food vacuole (Fig. 1d)."
  • Microscopy type: EM
  • Microscopy method: GFP, antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: FV during troph
  • Other genes localised in this publication: cysteine proteinase falcipain 3, chloroquine resistance transporter

Dahl, E. L., Rosenthal, P. J.
Biosynthesis, localization, and processing of falcipain cysteine proteases of Plasmodium falciparum. (2005 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

food vacuole during early schizont and early trophozoite and late schizont and late trophozoite, during not early ring and not late ring
  • "FP-2 and -3 localize to the food vacuole of trophozoites and schizonts"
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: W2
  • Gene model mapping comments: Blast from AF239801, inconsistent 5' UTR
  • Localisation record: FV during early troph and late troph and early schizont and late schizont, not during early ring and late ring
  • Other genes localised in this publication: cysteine proteinase falcipain 3

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10073

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF11_0165 cysteine proteinase falcipain 2a
MDYNMDYAPHEVISQQGERFVDKYVDRKILKNKKSLLVIISLSVLSVVGFVLFYFTPNSRKSDLFKNSSVENNNDDYIIN
SLLKSPNGKKFIVSKIDEALSFYDSKKNDINKYNEGNNNNNADFKGLSLFKENTPSNNFIHNKDYFINFFDNKFLMNNAE
HINQFYMFIKTNNKQYNSPNEMKERFQVFLQNAHKVNMHNNNKNSLYKKELNRFADLTYHEFKNKYLSLRSSKPLKNSKY
LLDQMNYEEVIKKYKGNENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAIRKNKLITLSEQELVDCSFKN
YGCNGGLINNAFEDMIELGGICTDDDYPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFA
FYKEGIFDGECGDQLNHAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFI
PLIE

Gene-Specific Links for PF11_0165

General Sub-Cellular Localisation Links