ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0147 (map-2)

mitogen-activated protein kinase 2, a gene from Plasmodium falciparum

Compiled localisation
during gametocyte and not merozoite and not ring and not schizont and not trophozoite

Who localised this protein by microscopy?

Dorin, D., Alano, P., Boccaccio, I., Ciceron, L., Doerig, C., Sulpice, R., Parzy, D., Doerig, C.
An atypical mitogen-activated protein kinase (MAPK) homologue expressed in gametocytes of the human malaria parasite Plasmodium falciparum. Identification of a MAPK signature. (1999 Oct 15, J Biol Chem) PubMed / full text
   more detail about this publication

during gametocyte and not merozoite and not ring and not schizont and not trophozoite
  • "Hence it appears that Pfmap-2 mRNA is expressed in sexual forms but is undetectable in asexual parasites. "
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: blast from X98689, annotation matches
  • Localisation record: during gametocyte and not asexual stages
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_20419

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF11_0147 mitogen-activated protein kinase 2
MLKKKKDYENADLEDCNTKEIKGYSKVGSEKNIKKKMTSIKESSSRDEEEEDANVNKNIKKFKEGNKKDNISKNCNIVEK
KNNKSKEEKINIKEAIIKNVKVPDNYEIKHLIGRGSYGYVYLAYDKNANKNVAIKKVNRMFEDLIDCKRILREITILNRL
KSDYIIRLHDLIIPEDLLKFDELYIVLEIADSDLKKLFKTPIFLTEQHVKTILYNLLLGEKFIHESGIIHRDLKPANCLL
NQDCSVKICDFGLARTINSDKDIHIVNDLEEKEENEEPGPHNKNLKKQLTSHVVTRWYRAPELILLQENYTNSIDIWSTG
CIFAELLNMMKSHINNPTNRFPLFPGSSCFPLSPDHNSKKVHEKSNRDQLNIIFNVIGTPPEEDLKCITKQEVIKYIKLF
PTRDGIDLSKKYSSISKEGIDLLESMLRFNAQKRITIDKALSHPYLKDVRKENLENFSTEKIILPFDDWMVLSETQLRYI
FLKEIQSFHADLIIPAKLNIHQKSFYNM

Gene-Specific Links for PF11_0147

General Sub-Cellular Localisation Links