ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0139 (PRL, EP)

protein tyrosine phosphatase, a gene from Plasmodium falciparum

Compiled localisation
apical and endoplasmic reticulum associated vesicle and endoplasmic reticulum and food vacuole during schizont and trophozoite
beyond erythrocyte membrane during late trophozoite and schizont

Who localised this protein by microscopy?

Singh, M., Mukherjee, P., Narayanasamy, K., Arora, R., Sen, S. D., Gupta, S., Natarajan, K., Malhotra, P.
Proteome analysis of Plasmodium falciparum extracellular secretory antigens at asexual blood stages reveals a cohort of proteins with possible roles in immune modulation and signaling. (2009 Sep, Mol Cell Proteomics) PubMed / full text
   more detail about this publication

beyond erythrocyte membrane during late trophozoite and schizont
  • "Immuno-localization of four novel secreted proteins confirmed their export beyond the infected-RBC membrane."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly against protein
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: beyond RBC membrane during late trophozoite and schizont
  • Other genes localised in this publication: conserved Plasmodium protein, unknown function, ubiquitin-protein ligase, putative, protein kinase

Pendyala, P. R., Ayong, L., Eatrides, J., Schreiber, M., Pham, C., Chakrabarti, R., Fidock, D. A., Allen, C. M., Chakrabarti, D.
Characterization of a PRL protein tyrosine phosphatase from Plasmodium falciparum. (2008 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apical and endoplasmic reticulum and endoplasmic reticulum associated vesicle and food vacuole during schizont and trophozoite
  • "As represented in Fig. 4B, PfPRL associates with the ER and other non-ER punctate (presumably organellar) structures close to the parasite plasma membrane. PfPRL also substantially overlapped PfAMA-1 at the apical end of the individual schizonts although no obvious co-localization was observed in pre-schizont stage parasites (Fig. 4C and data not shown). This apparent packaging of PfPRL and PfAMA-1 within the same compartment in schizont parasites is suggestive of a parallel function of PfPRL in merozoite release and/or invasion. As indicated in Fig. 3 and Fig. 4, PfPRL is also targeted to a single subcompartment of the digestive vacuole that measures approximately 600 nm in diameter in trophozoite parasites."
  • Microscopy type: Light
  • Microscopy method:
  • Strain: 3D7
  • Gene model mapping comments: Blast from AAW34267, annotation matches
  • Localisation record: ER and ER associated vesicles and apical and food vacuole foci during troph and schizont
  • Other genes localised in this publication: heat shock protein 70, ER lumen protein retaining receptor, apical membrane antigen 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11539

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF11_0139 protein tyrosine phosphatase
MKSLENNEMHNLCPIHYYFNGRDYNSDTIINNVNIKYFNMDNCLGNANLHMDYLNPVLNHPTKIEHGKIKILILDAPTND
LLPLYIKEMKNYNVTDLVRTCERTYNDGEIQDAGINVHELIFPDGDAPTEDIVSNWLNIVNNVIKNNCAVAVHCVAGLGR
APVLASIVLIEFGMDPIDAIVFIRDRRKGAINKRQLQFLKEYRKKKKKKNCLRKCHFM

Gene-Specific Links for PF11_0139

General Sub-Cellular Localisation Links