ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0098 (ERC, ERC1, Pfs40, Pf39)

endoplasmic reticulum-resident calcium binding protein, a gene from Plasmodium falciparum

Compiled localisation
endoplasmic reticulum during early trophozoite and late trophozoite and ring and schizont and trophozoite
not parasite plasma membrane during late trophozoite

Who localised this protein by microscopy?

Yeoman, J. A., Hanssen, E., Maier, A. G., Klonis, N., Maco, B., Baum, J., Turnbull, L., Whitchurch, C. B., Dixon, M. W., Tilley, L.
Tracking Glideosome-associated protein 50 reveals the development and organization of the inner membrane complex of Plasmodium falciparum. (2011 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

endoplasmic reticulum during trophozoite
  • "The profile is dispersed and coincident with the pattern for the ER resident protein, PfERC (ER calcium binding protein), in trophozoite stage parasites (Figure 4B, upper panel)."
  • Microscopy type: Fixed Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: endoplasmic reticulum during trophozoite
  • Other genes localised in this publication: glideosome-associated protein 50,secreted acid phosphatase, glideosome-associated protein 45

Kavishe, R. A., van den Heuvel, J. M., van de Vegte-Bolmer, M., Luty, A. J., Russel, F. G., Koenderink, J. B.
Localization of the ATP-binding cassette (ABC) transport proteins PfMRP1, PfMRP2, and PfMDR5 at the Plasmodium falciparum plasma membrane. (2009, Malar J) PubMed / full text
   more detail about this publication

endoplasmic reticulum during early trophozoite and ring and schizont and trophozoite
  • "The glycophorin-A antibody was used to stain erythrocyte membranes thus contrasting them from parasite cells while the PfERC antibody, which binds to an intracellular calcium binding protein located on the endoplasmic reticulum, was used to determine intracellular localization of the pfABCs."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: NF54
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER during rings and troph and schizont and ring and early troph and dividing troph and schizont
  • Other genes localised in this publication: ABC transporter, (CT family), putative, ABC transporter, (CT family), ABC transporter (MDR family), putative

Quevillon, E., Spielmann, T., Brahimi, K., Chattopadhyay, D., Yeramian, E., Langsley, G.
The Plasmodium falciparum family of Rab GTPases. (2003 Mar 13, Gene) PubMed / full text
   more detail about this publication

endoplasmic reticulum during schizont
  • "Clearly, PfRab1A and PfRab11A display different distributions. Panel (E) shows the pattern obtained with anti-Pf39 antibodies specific for the endoplasmic reticulum."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER during schizont
  • Comment: strain information not found
  • Other genes localised in this publication: Rab GTPase 1a, Rab GTPase 11a

Delorenzi, M., Sexton, A., Shams-Eldin, H., Schwarz, R. T., Speed, T., Schofield, L.
Genes for glycosylphosphatidylinositol toxin biosynthesis in Plasmodium falciparum. (2002 Aug, Infect Immun) PubMed / full text
   more detail about this publication

endoplasmic reticulum

Adisa, A., Albano, F. R., Reeder, J., Foley, M., Tilley, L.
Evidence for a role for a Plasmodium falciparum homologue of Sec31p in the export of proteins to the surface of malaria parasite-infected erythrocytes. (2001 Sep, J Cell Sci) PubMed / full text
   more detail about this publication

endoplasmic reticulum during trophozoite

La Greca, N., Hibbs, A. R., Riffkin, C., Foley, M., Tilley, L.
Identification of an endoplasmic reticulum-resident calcium-binding protein with multiple EF-hand motifs in asexual stages of Plasmodium falciparum. (1997 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

endoplasmic reticulum and not parasite plasma membrane during late trophozoite
  • "Confocal immunofluorescence microscopy of asexual stage parasites was used to show that PfERC co-localizes with the known ER-located protein, Pfgrp. Analysis of immunoblots of tightly synchronized parasites showed that expression of PfERC increases with increasing maturity of the parasite. ... PfERC appears to exactly co-localize with Pfgrp (Fig. 4, Panels B,D,F). Thus, in contrast to the previous report of Rawlings and Kaslow [22 that suggested that Pfs40 is located at the surface of the gametocyte, we found no evidence of surface localization of Pfs40/PfERC in asexual parasites."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: FCR3, D10
  • Gene model mapping comments: Blast from AF016410.1, annotation matches
  • Localisation record: ER and not surface during mature trophozoite
  • Other genes localised in this publication: heat shock protein 70

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13205

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_093840 endoplasmic reticulum-resident calcium binding protein, putative
  • PY05050 membrane-associated calcum-binding protein
  • PVX_091105 membrane-associated calcum-binding protein, putative
  • PCHAS_090590 endoplasmic reticulum-resident calcium binding protein, putative
  • PKH_090580 endoplasmic reticulum-resident calcium binding protein, putative
  • TGME49_029480 membrane-associated calcum-binding protein, related
  • NCLIV_030420 Rcn2-prov protein, related
  • cgd2_3990 protein with signal peptide, ER retention motif and 4x EF hands
  • Chro.20427 membrane-associated calcum-binding protein
  • CMU_002970 EF hand domain-containing protein
  • BBOV_III007520 membrane-associated calcum-binding protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF11_0098 endoplasmic reticulum-resident calcium binding protein
MMKINLYKLLCFICVIFLLHKNVVRSGDNMKYNDMKGLDDLSKLNDDQVKDILGLKIDGAKERIEKLFHLIDKNNDKEIT
EEELNTWSSFLKNEIFLKQVQAEMGQIDSDKDGFISLNELNDAFAQNLDAKEVEKHSEGLLKRFQIVDKDKDGKLSINEV
GLLIDPMKDEELKELEINEILEHHDVNKDGKISLDEFKQTRSDESSGVKKDDEMALDDFNFFDANKDGFIDKEEIIKVYF
DPAHESGAINVNEIKENIFEGKKITYDLWNEKALKIAVTSLTDYGDVIRYPEDFKLDIGKNVILPTARSRAFEDDDMDAD
NTEDDKDEADDASQQKSPAIDEL

Gene-Specific Links for PF11_0098

General Sub-Cellular Localisation Links