ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0086 ()

MIF4G domain containing protein, a gene from Plasmodium falciparum

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11313

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF11_0086 MIF4G domain containing protein
MQSDIIVNQDLKEYSNMMKGIHHVKSCVSSLGVETNMKNEYNEKVVERNDYNNNIEDETYDNNNININNNNNNNDNNDNK
DELLNSSNDLINEKKNKKNKKNSYDDSILCNNRGSINDENLDIPNNCDTSHNNNNNSIHGDNNVFEKRNNSQDVHSSSIL
KNSEDLILNKSSNNSNNENVYSNEDMYSYKENLCEQQNNDETNNMFPSKINMDNCNINNNYSNNNSSSNSSRSYNESKKS
SKDENNNNDNDNRDNNNNNNNNNNNNGNNANNGNNGNNGNNNNNNNNGNNGNNGNNNNEGNDNNDDNKNNDENKNNNKEV
SDDKDKDEHDEKGSNENKNLSHNNNNNNNNNGSSSNNNNNLNGDNKKNEGNKKNETSSIKSLHKSSVLSSLNADAPEFVP
STKSLQNNMSFNNLMWNNYYQDISGGTTFNSNNLLNNMNNTPGSNNNNNIMINNTNSLLHNMNGINNNSSNNIMNIAGSN
TMSSSNNNNSVNSGVVLLGVSSGNMNNMDNNDQDKMNTTTNNNNNTNNNNNNNNNNNSNNNICNNSLHGAKSNSNHNNIH
DNNNNNNMHAGNINNISQTIGGMSSNDGPFINQGMMPGITNLRSSHFMSNSSANFMNNSENSNGPFHPMDGTHAHQNFQP
NGSLIAHHNFYVNHHPYILNNHPNPLPGPQPIFAPPLPYTNTLTSTGNTTGAGGVHHDMPFAQHTSVYGSFSNNPANLIA
SGASISSQKSPSLSINPYNFLSCSLPTPPPQLPHTGPLSMTSLDPHFMSTGNNSHMKLPYTNNMCPHPGRRSIYNHFSHA
HISNSNNMNDNNFDPTNSNNNNNNNNNNNNNNNNGNNNNNGNNNTMAANLNYNFNTFNHPNNNNSCALVLNNDNNSTNNI
HLNQGLNSNTLNLNNTGNVICVNNPMHLNTSGNMTHHHMNNMHMNHGMIINNNIGKQKKSISMNHNNTDNNNNNNNNNNN
NINNNNNNVKQQFNNYREGKNSLKGNMMNSNVCINNNYNHYNSPNNNNNNNNNNNNKKHSRYNSISNLNNAYNAAYNINT
TGNNVNNISSNNSKNIYNSKGVKREGYNSEDNDNTAGNYYLKNGNPIMNVANTNNTNNTNNANNANNANNTNNTNNANNA
NNTNNTNNANNTNNTNNALDHVNVEGSNNKSKDTNNQELKDSNENNNNNNDVENDNFNDSSFSYKGQKNYNSKNKSNTSI
NNNYNINNIQNDKIPNTHKEDYKNNRYVNNNKILEDKNSSNANKNMTNEKNLKATDNNVYHNNKKGYNDVPNNSSHNNNN
NNNNNNKQNNSYLNNNKYHQNHSDRRGSNIKNAESNTNKMNEKKIKNDDEKKGKEKEKEKEKEKEKENINNNSHNNNKKM
SEIHTNNENNYVGNKNMNYNTLKNYKNYDKKTMEFSSWVKIAKMNPNNNNNNNNNNNNNNKKKEKLSVSSIYEGSNNEKN
QNVEDRRNSNFINEKINTQDNKTSNPYSSKNQNKENDDNVLFQHKDNENNQEYDNNEDHNNNNNRRLSGNVNNENMKKRN
EDEDKKRSSKASIKEKENNAHYYKDSNNNKKLNDENKKMSYNNIVTNNRNYNTAKDNNKEKNKLKYESNKKTEMDDRRNS
VGVTANAVGSTPGSSNTFSHRQREKLKIQNVEIKQINEKIINIKNYDKKKTSVTNVHNSNDEGTKGKGAYTHNRKDEKKE
DTTNNVDSKKNDMNDPKSIDALTENENNKNDAECSDSTTVKNKKGKRTSTNNVSSNSLKNESMKSSTTNKEQVSKDIVAS
NNMSNTSKSSNNGDINVIKRNNNNNNNNNNNTGMNKGQDKGANTGESNNNNNNNNNNNNNSSSISSSSAVPNVNESSKNT
SVYASIKNSLWQGRISFAEMAKRKPKVETKEIKETKAESVTSEKKNNHKNNNNNNNNNNNNSNHHHHRNSINNHHSNKSD
KSSRKEHHSRYGSSSTTREKAVSSNNTVMKEYSKDSRKKNDHKDESSVHSFNSSRLNKKDNKNDARHKSENKNKLYNNEH
VDSYDSGVDCVSVQNKKKETDKADDISVCDTISVIEKKEDFEELKDEKNLDNYTYNEKVSDYSNEKNNVREDLHEDLHED
LGEDLHEHYVDNKEDQYESVSQKGKCSNENIKDENEIKNNDTNNNENNNNENNNNENNNNENNNETIVSNEDQKIKEEKT
VAVNIDEVLFEEKENKKDENECSQVDRVNINNDITKVDEEKKMDEIITCEKNISNENKQSGDNNKLEKEKNDKNEIYEKN
DKNEIYEKNDKNEKNDKNEKNEKNEICEKNEICEKNEIYEKNEICEKNEKNDNKLEKSSDEHMNEKISDNVKVNDEGTLL
LENLEEKVQNADEIEENKEKKNIVNDEKEKAKQKKLERLYREKIYTKIDLLEIYLGHNWGEDGDRFNFVLSQENDNLLDG
DYKNSISNNNMMNNNRHSVMMDDHHNIMKNNNNNNNNNMGNNSNNNHHHHHMNEQKNMNAHNKRFNNNMNNMNNINNVNN
MNSGYNNNMNNKNNNNNNMNQHNHHSGHHHIINNKQNQSNQNVNNKNNDDGWRNSIAQKNMMNNNNNNNNNMYINNNQNN
NFYDHSNNNNNNMNDMNMQNIHMNNMNNMNNMNNMNNMNNMNNMNTINYNNSVSSNLEWRKSDADKLKGFFDSTRVVESA
DAWRNNNNNNNNNNNNSNNNNTGQVKTVAENSWILKQNQLKADKYTCMMRKLRGILNKLTFEKFDLLYEQIILVGITKLD
EIIGLMKLVFEKAVTQHHFVQMYVQLCKKLNVHFHNMKLEDDTTVQFKKILINQCQDSFENNLKPIEFPSHLNEEEKFEF
EQMHKNKVRGNMLFVGELVKSGIISIPIVFVCIKQLLEKRESYISIKNDTKEGNLHLEALCMFLNTVGEILDTHEKANQE
KVKELYNTLNELVNNESITFRVRCLIKDVIDNRNEKWNKKFAHKLEGPTTLSVLHDKILKETIDQNNRTYNHNNNMNYHE
NKMNNNLSNMRNNLLRNVSFNMNNNNNNNNNNNNNNNNNNNNNISFGNMMNNNNMNLRNMGNMKNMDQNKNMKKLSLNLM
KNKNNLQQSKMMNDDMKGTNMENNYFDIPKRESLFNKNSSFSKEDANNACTNNNNNNNTSSGTSNSFFSNLSSRLLNKEK
KEGGGGNIFSRSFNLKKNNNISNISNNDLDKKDKTNMNTNKNEEKDNTFTNKDNVLNTKVDNTNEEPKDYTFVEEYIPKV
NEILELSTTIENWEELTEKLVQLHIPPKFNEKLHAHILKHTLKKYACNKNVERSLPYFNWLVSIVLDNKIDMESFKHCWK
SFFLESDENSYEYTKEDYPLLPRLVTNFISAVELYDKNHMLYDLSTLEQMKSVI

Gene-Specific Links for PF11_0086

General Sub-Cellular Localisation Links