ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0053 (SNF2L) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

chromatin remodeling protein, a gene from Plasmodium falciparum

Compiled localisation
nucleus during intraerythrocytic

Who localised this protein by microscopy?

Ji, D. D., Sultan, A. A., Chakrabarti, D., Horrocks, P., Doerig, C., Arnot, D. E.
An RCC1-type guanidine exchange factor for the Ran G protein is found in the Plasmodium falciparum nucleus. (1998 Sep 1, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

nucleus during intraerythrocytic
  • "While the pre-immune sera does not react with the isolated nuclei, antibodies raised against SNF2L, a chromatin associated ATPase, and antibodies against RCC1 both react with the isolated nuclei."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: Blast from AF003086, annotation matches, gene model inconsistent
  • Localisation record: nucleus during asexual
  • Other genes localised in this publication: guanidine nucleotide exchange factor

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10573

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF11_0053 chromatin remodeling protein
MFRNVRDYFKSSNDVNEEKKNDVGSVHMDENTENYDKESNGFVHRDFNNGINKEDKDYEELDLKKLNVSSNDITKEGNNM
NENMMNRKLNSSVEDGNDNNHDKNVHRNIGNDTHVSYDDKRKSYLDNNEENSEQMNDNMKKRKLNEISYDNNEEDEFRNK
KDDSMEMNDKEKGSTNMSTINDNNNNHNDDSNNHNDDSNNHNDDSNNHNDDSNNHNDDNNNHNEDNNNHNDDNNNHNDDN
NYNSEEKPNYLQEKLEQLLAQTKRYTEKLAGQRLKMNAQMKSSKKGRCLLTEKEEDFMLLKDANEEDEAIILKQPMNING
TMKPYQLEGLNWLYQLYRFKINGILADEMGLGKTLQTISLLCYLRFNKNIKKKSIIICPRSTLDNWYEEIKKWCTPMKAF
KYYGNKDQRKELNRNLLHSDFDVLLTTYEIVIKDKSALYDIDWFFLVIDEAHRIKNEKSVLSSSVRFLRSENRLLITGTP
LHNNLKELWSLLNFLMPKIFDNSEEFDNLFNISKISTNDNKQSEIITQLHTILKPFMLRRLKVEVEQSLPPKREIYIFVG
MSKLQKKLYSDILSKNIDVLNAMTGSKNQMLNILMQLRKCCNHPYLFDGIEEPPYIEGNHLIETSGKMSLLDKLLPRLKK
ENSRVLLFSQMTRLLDIIDDYCRWKNYPYLRIDGSTPGDERQVRINQFNEPNSKYFIFLLSTRAGGIGINLTTADIVILF
DSDYNPQMDIQAMDRAHRIGQKKRVIVYRFVTQNSVEEKIVERAAKKLKLDSLIIQKGKLNLNSAKENNKQELHDILNFG
APEVYKTQDISSISDEDIDIILADAEKRTIEIEKKLKNLENIFDLTNISLDGGLNMYNDLEKEASEESTDEEDSSGSGEE
TILEGSGNNDIVEENGVKKKKKKKKNINKIRRTIKKFLKNNKKNMTFLDLGERKSKWKVMNTACGRTNKKKMVLHGWRAE
ARGGHDFQFFNVEKLDELEKIEDKWNNYMINQEKINVLIEAQNEEKDYEKIVTFNEFLDKHAKNIYQIITLINPSLFDEH
KDTKEEELLKMGTHSDVNSNDKDYKRSSFMSTDYNMKTTYLNNINSNNNNNNNNINDNVGTSINTIDDQQYFKKKILSLF
ESGKKLQMIKFKDRNIKNCYTQVANFIKKNFPEKINNNDTNNNKSTTLKNKKLKKGKQTKNVNVEKDIASVDIEKIKLQK
QELMKQGFAKWNKAEFNKLMSGLIIYGTNEVEYIYEKYFSNSKKSMEDIKAYLTVFFRKYDQIKGGVRLFDKIKRSDLQK
KIIEEENDMITEFVEKQLSEGVDSIEKLQLPSNLRYDFMEKREVLNITEEVKTENEENVLSNEELAYYDRENKILLWLLY
QQGVVQIKNIHILTPYYWPEAYNFFKYATTPFENVEYRCRLIVDAIAELYAKKENVPLNNKDKRRI

Gene-Specific Links for PF11_0053

General Sub-Cellular Localisation Links