ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0407 (PDH E2)

dihydrolipoamide acyltransferase component E2, a gene from Plasmodium falciparum

Compiled localisation
nowhere except apicoplast during intraerythrocytic

Who localised this protein by microscopy?

Foth, B. J., Stimmler, L. M., Handman, E., Crabb, B. S., Hodder, A. N., McFadden, G. I.
The malaria parasite Plasmodium falciparum has only one pyruvate dehydrogenase complex, which is located in the apicoplast. (2005 Jan, Mol Microbiol) PubMed / full text
   more detail about this publication

nowhere except apicoplast during intraerythrocytic
  • "Colocalization with the apicoplast-resident protein ACP using -ACP antibodies unambiguously shows that the presequences of PDH subunits E1 and E2 are sufficient to target proteins exclusively to the apicoplast (A and C)."
  • Microscopy type: Light
  • Microscopy method: GFP tag after 61 amino acids
  • Strain: D10
  • Gene model mapping comments: Blast from AY484443
  • Localisation record: Apicoplast only during asexual
  • Other genes localised in this publication: pyruvate dehydrogenase E1 alpha subunit, acyl carrier protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10806

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_050500 dihydrolipoamide acyltransferase, putative
  • PY04573 putative dihydrolipoamide S-acetyltransferase
  • PVX_001900 dihydrolipoamide acetyltransferase, putative
  • PCHAS_050510 dihydrolipoamide acyltransferase, putative
  • PKH_060480 dihydrolipoamide acetyltransferase, putative
  • NCLIV_044290 Pyruvate dehydrogenase E2 component, related
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF10_0407 dihydrolipoamide acyltransferase component E2
MLYNLIILIFYLRFSKCISKNNNYGYINFGTFSNVVNNSNNLRNRKNVVFSKIEIKMPALSSTMTTGKIVKWNKNIGDYV
NLGDIIMTVESDKADMDVEAFDEGFLRVKRLEDGCEANVGDVLGVLTTEENENMDEKKYNDGDINKTENEIKVLNPDKDK
SEQIIKEDIHFVKKHINDDVNEEKIFIPFIKCKKKKAKINKWLKNENDFVKKNDLLLYVEDDKSTIEVESPYSGIIKKLL
VKEGQFVDLDKEVAIISITEEKDNEKEKIEEPFKNKEDEEINRDNILIHYINKIKKSEEGRKFLKNLSEQEEKTLEERLK
LNYEKYNKISNDLFRSSESTKDYVLKEKENESQYEMVLPSASELMRQNKLNPKDITNRKTPNRITYEDVDAFLNGHKNNS
TNVTYCEKPKVETIEYGDPKTVDMTNIQKSIKNNMMLTLTVPVFRVTHLIKTNELLKLYEKVKQKISMSVIINKCVSSVL
LNHPLIYSTYIDKDNGKILYNKDVNIGNALGLPDSLLTPVLKKVDKKDIYTLANEWKILVEKGKNGLLSSNDMTGSNFYI
SNLGMFNTYQFDAILPKNSSCILSIGTNIGSIDNLEDLKIQKGMMMTLTCDHRHIYGSHAAAFMNDLSKFIEKDIMKIFL

Gene-Specific Links for PF10_0407

General Sub-Cellular Localisation Links