ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0395 (STEVOR)

stevor, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte cytoplasm during early schizont and late schizont and late trophozoite and middle schizont
nucleus during late schizont
maurer's cleft

Who localised this protein by microscopy?

Kulzer, S., Rug, M., Brinkmann, K., Cannon, P., Cowman, A., Lingelbach, K., Blatch, G. L., Maier, A. G., Przyborski, J. M.
Parasite-encoded Hsp40 proteins define novel mobile structures in the cytosol of the P. falciparum-infected erythrocyte. (2010 Oct, Cell Microbiol) PubMed / full text
   more detail about this publication

maurer's cleft

Blythe, J. E., Yam, X. Y., Kuss, C., Bozdech, Z., Holder, A. A., Marsh, K., Langhorne, J., Preiser, P. R.
Plasmodium falciparum STEVOR proteins are highly expressed in patient isolates and located in the surface membranes of infected red blood cells and the apical tips of merozoites. (2008 Jul, Infect Immun) PubMed / full text
   more detail about this publication

erythrocyte cytoplasm during early schizont and late schizont and late trophozoite and middle schizont, nucleus during late schizont
  • "IFAs showed that this anti-STEVOR antibody gave a punctate staining pattern throughout the iRBC, present from the late trophozoite stage and throughout early/mid-stage schizont development in 3D7, D10, and K1657 (Fig. 3 and data not shown). However, in the highly developed segmented schizont, the staining pattern of STEVOR was more diffuse both around the parasite nuclei and throughout the iRBC cytosol, with some potentially associated with the iRBC surface membrane."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7, D10
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: punctate iRBC during late troph and early schizont and mid schizont, diffuse parasite nucleus and diffuse RBC cytoplasm during segmented schizont
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_15390

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF10_0395 stevor
MKMYYLKMILFNFLINTLLLPHYENSQNKHYNISLIQNNTQGTTIKSRLLAQTQNHNPHYHNDPELKEIIDKLNDEAIKK
YQKTHDPYKQLKEVVEKNGTKIRGGNSAEPMSTIEKDLLEKYEDVFGDKNHAMLKSGRYPNDDDESDDSSSCGCTDINNA
ELEKTKGRDKYLKHLKGRCTRGIYSCSVISAFLTMLGLTAAKTAAKGALAEYAAYETCLSSIPIFSLPGNSTVFSALQAG
TEICATHASDLAGIISTPAMAAFEPYGIAALVLLILVVVIIILYIWLYRRRKNSLKHQCKKHLCK

Gene-Specific Links for PF10_0395

General Sub-Cellular Localisation Links