ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0374 (Pf11-1) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

Pf11-1 protein, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte cytoplasmic structure near parasitophorous vacuole during gametocyte
membrane of lysed erythrocyte during gamete
during not intraerythrocytic

Who localised this protein by microscopy?

Scherf, A., Carter, R., Petersen, C., Alano, P., Nelson, R., Aikawa, M., Mattei, D., Pereira da Silva, L., Leech, J.
Gene inactivation of Pf11-1 of Plasmodium falciparum by chromosome breakage and healing: identification of a gametocyte-specific protein with a potential role in gametogenesis. (1992 Jun, EMBO J) PubMed / full text
   more detail about this publication

erythrocyte cytoplasmic structure near parasitophorous vacuole during gametocyte, membrane of lysed erythrocyte during gamete, during not intraerythrocytic
  • "The Pf11-1 protein was localized by electron microscopy to granules in the cytoplasm of gametocytes adjacent to the membrane of the parasitophorous vacuole. Following in vitro stimulation of gametogenesis, the Pf11-1 protein was found in the membrane of lysed erythrocytes, suggesting a role for Pf11-1 in erythrocyte rupture within the mosquito gut."
  • Microscopy type: EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: Banjul, FCC1, ITG2G1, T996, FCR3, Palo Alto, 3D7
  • Gene model mapping comments: blast from X07453, annotation matches, gene model inconsistent
  • Localisation record: granules near PV in erythrocyte cytoplasm during gametocyte, membrane of lysed erythrocyte during gamete, not during asexual
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10046

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF10_0374 Pf11-1 protein
MKKESYRFLNISINNGSDKKKKSNFFVKIKNGTDLKDTKKDRIRFHFYFYFFIVKIILLSLLIWTVIYSNNCSNGKYKST
LYIVGNHLRFRGFRILAENEYEMKTKYKTLMVNIDDNDLGKRGNKIKPKHKKVEINLNDNNLSNNESKRKSRRKKVKVNL
KDNLAKREGKMKRRNKKEKRRKEKDNKKMNELKLKREYKESYLLDNKSDMDVIRNDKFSYFTLYKNNLFPNSNNYFLHML
KTYDEENKGIDENTDINENVEENEYVDKNTEGDKDGDEDKGGGESEGGDGHGSAGDSAGGDRGGDENKDKDNEENKDKKG
NKDDDDEEEEEEEEDDEEKEEKDEKDEKDEKDEKDEKDEKDEKDEKDEKDEKDEKDEKDEKGEKDESKGEEKFLKEEKMP
KKEENMQDKIERDKEFEGFKDEYFTQMEGGAYGITVEHEGQKLRETLTEGVEGYEKVIEEMEQTKLDEFLLPTNEGKSDD
FVSEMEEERLFNFVSYMEEEVKDKMFIEREQGTEEEVIHEDLSDEKIGIEKKELETFVQDVSDEVLQDEQLIEEEKLTEE
EKLTEEEKLTEEEKLTEDEQLIEEEKLTEEEKLTEEEKLTEEEKLTEEEKLTEEEKLTEEEKLTEEEKLTEEEKLTEEEI
FIEEDKISPKEVEEPLEDVLMEKMEKEYKEILHEGKSVVTQDMDEKLLSENLEDDLIPEEIIEELVDEELVEEVTAEEIV
EEFVAEVEIEEKIPKELVEEVMPEEDVDEVVPEELVEEVVPEELIEGVIPEELVEDVIPEKVLEKVIPEEIIEELVLEEV
VEEIKHEELVEEEIPEEVTEEVIPDEVVEEVIPEELIEKVVKEELVEKVVAEEIVEEVVPEELVEKVVAEEIVEEVIPEE
LIEEVITEKPAEEVIPEELVEEVIPKEIVEEVLPEEVVKEVIPEEVVEEVIPEELVEEVIPEEIVEEVVPEELVEEMKPE
EVVEEVISEELVEEMKPEEVVEEMKPEEVVEEVTPEKVVEEVVPEELVEEMKPEEVVEEVISEELVEEMKPEEVVEEVTP
EKVVEEVVPEELVEEMKPEEVVEEVISEELVEEMKPEEVVEEVISEELVEEMKPEEVVEEVTPEKVVEEVVPEELVEEMK
PEEVVEEVISEELVEEMKPEEVVEEVTPEKVVEEVVPEELVEEMKPEEVVEEVISEELVEEMKPEEVVEEVVPEELVEEV
IPEEVVEEIIPEEVVHEAKHEELFEKTVPEVEVQEIIPKELVEVIPEEVLPEELIEEVIPEEIIEEVIPEEVVEEVIPEE
IVQEVIPEDLMEEVVPEEIIEEKILEEIVEEEIHEEIVEEIISEEVVEEVVPAEVVEEMIPEKLVEEVIPEELVEEVISE
ELVEEVVPVEVLEEVVPVEVLEEVIPEEVVEEVIPEEFIEEMIPEEIVEEVVPEVVEEVIPEELVEEVVPVELLEEVIPE
ELLEEVIPEELVEEVVPEELVEDVIPEELIAEVVSEELVEEEIPEEVLEEVIPEELVEEVIPEELVEEVIPEVLVEEVIP
EELVEEVIPEVLVEEEVPEELVEEVIPELLVAEVIPEELVAEVIPEEFVEEVIPEEVVEELVPEELVEEVIPEEIVEEVV
EEVVEEIIPEEVIEEVIPEEIVKEVVPEVLVEEVVPEEIVEEVVPEEIVEEVVPEELVEEVVPEELIEEVIPEELVEEVI
PEVLVEEVIPEVLVEEMVLEELVEEVIPEVLVEEMVPEEVVEKMVLEEVVEEVIPEEVVEEVIPEEDVEQVIPEELIEEV
VPEEVIEEVITEEVVEEVLPEELVEKVVEEEILEEVIPEELVEEVVREELIEEVVTEELVEKVVEEEIVEEVVLAEVVEE
VIPQEIVEEVIPEEVVEEVIPKEIVEEVIPEELVEEVVPEELVAEVIPEELVAEVIPEELIEEVVTEELVEEVIPEEVVE
EVIPEEVVEEVVPEELVEEVVPEELVEEVVPEEIVEELLPKEVVEEVIYEEQVEEVIPEELVAEVIPEKLVEEVIPEELV
EEVIPEELVEEVVPEVVEEVVPEELVEEVIPEELVEEVIPEVLVEEEVPEELVEEVIPEELVEEMLPEELIEVVVPEELV
EEVVPEELVEEVVPEEVVEEVIPEELIEELVPEVEIEEILPEELIEELVPEEIIEEVIPKELIEEVIPEVVVEEVVPEVV
EEVVPEIVEEVVPEVVEEVVPEEIIEEKISEEVVEEVLPKEIVEEVIPEELVEEVVPEELVAEVIPEELVEEVIPEVLFE
EEIPEVVVEEVVPEVVEEEIPEVVVEEVVPEVVEEVIPEELVEEVIPEELIEEVIPEEVAEEVLPEELIEEVIPEELVEE
VVPEELVAEVIPEEIVEEVVREELVEEVVPEEVVEEVIPKEIVEEVVSEEVVEEVIPKEIVEEEVPEELVEVVPEELVEE
VVPEELVEEVVPEELVEEVVPEELVEEVVPEELVEEVVPEVVEEVQEQLVEEFIPEEVVEELVPEELVEEVIPEELVEEV
IPEEIVEEVLPEEVVKEVIPEEVVEEVIPEELVEEVIPEEIVEEVLPEEVVKEVIPEEVVEEVIPEELVEEVIPEELVEE
VIPEELVEEVVSEELVEEVIPEEIVEEVIPEELLEEVVEEVVPEIVEEVVPEVVEEVITEEVIPEELIKEVIPEELVEEV
IPEEIVEEVIPEEIVEEVISEEVVEEVVPEVVVEEVIPEEIVEEVLPKEIVEEVISEKVVEEMIPEELVEEVIPEEVVEE
VIPEVEIEEILPEELIEELVAEEVIEEVIPKELIEEVIPEKLIEDVVPEEIVEEVLPEEVVKEVIPEEVVEEVLPEELVE
EVIPEVVEEVVPEELVEEVLPKEVVEEVIPEVEIEEILPEEIIEELVAKEVIEEVIPKELIEEAITEEVVEEMIPEEIIE
EVVPEEVIEEVITEEVVEEVVPEEVIEEVITEEVVEEAIPEEVVEEVIPEVEIEEVLPEELIEELVPEEVTEEVITEEVV
EEAISEVVEEVIPEEIVKEVIPEEVVEEIITEEIAEEIIPKELVEEVIPEEVVVEIIPEKLVEEFVSEELVEELVPEEIV
EKVVPEELVEEIVPEELVEEVVPEELVEEVIPEELVEEFIPEEVVEEVLPEQLVEEVISEVVEEVVPEELVEEVIPEEVV
EELVAEEVIEEVIPKELIEEAITEEVEEVIPEEIVEEVIPEEVVKEVIPEVEIEEILPEELIEELVAKEVIEEVITEEVA
EEVIPEEIVQEVIPEEVVEEIITEVEIEEVLPEELIDEVVPEEVTEEVITEEVMPEEVVKEVIPEEIAEEVIPKELVEEV
IPEEVVEEIIPEVEIEEVLPEEVIEEVVPEVEIEELIPDEVVEEVLPEELVEEVIPEEVAVEVVPEEVIEEAVPEEIVEE
FIPEEQIEEVIQEEIIEQVVPEELIEEVVPEEIIEEVIPEEIVEEVIYEEVIPEELVEEVIAEKLVKEIVPEQVREEVTL
EEIVEEMIPEEFVEEVAPEVEIEEIIPEELIEEVIPEVLVEEAVPEELIEKVIPEVLVEEIIYKEGIPEVLIEEVIPEEL
VQEVIPEEIVEEVVPEEFIEEMIPQEVVKEVITEKFIEEMIPEEVVEEVIPEEFIEEMIPEVVVEEVVPEELVEEMLPEE
LIEVVVPEELIEEVIPEELVEEVVAEELVEEVIPEELVEKVVPEVVEEFIHEVVEEVVPEVVEEVVPEVVEEVVPEVVEE
VVPEVVEEVVPEVVEEVVPEVVEEVVPEVVEEVVPEVVEEVVPEVVEEVVPEELVEEVIPEVLFEEEIPEELVEVVPVEL
LEEAIPEELVEEVIPEELVEEVIPEELVEEVIPEELVEEVILEELVEEVIPEELVEEVIPEELVEEVIPEVLVEEEIPEK
LVEEDIPEKLVEEVVPEELVEVVIPEELVEEVIPEELVKEVIPEELVKEVVPEELVEEEIPKVVEEVLPEELVEEVMLEE
VVEEVVPEIVEEVVPEELVEEVVPEVVEEVVPEEIVEEVIPEELVEEVVKEELVEEVVKEELVEEVVKEELVEEVIPEVL
VEEVVPEELLEEVIPKVLVEEVIPELLVEEVVPEVIEEVVPEVVEEVVPEELLEEVIPEVLVEEEIPEKLVEEVVPEELV
EEVIPEVLVEEVVPEELVEEVISEELVEEVIPEELVEEVIPEEVVEEVVPEVVEEVVPEVVEEVVPEVVEEVVPEVVEEV
VPEVVEEVVPEVVEEVVPEVVEEVVPEVVEEVVPEVVEEVVPEELIEEVIPEEIVEEVIPEELVAEVIPEKLVEEVIPEE
LVEEVIPEELVEEVIPEELVEEVLPEEVVEEAVPEVVEEIVPEELIEEVIPEELIKEVVPEEVIEEVITEEVVEEVLPEE
IVEEVLPEEVIEEVVPEELVEEVLPEEVVEEVVPEELVEEVVPEELVEEVIPEELVEEVLPEEVVEEVVPKELVEELIPE
ELVEEVIPEELVEEVVPEELVAEVIPEELVEEVIPEELVEEVIPEELVEEEIPEELVEEVILEELVEEVVPEELIEEVVP
EELIEEVVPEELIEEVVEKVIPEEIIEEVVPEEVIEEVITEEVVEEVVPEKVIEEVITEEVVEEVVPEEVIDEVITEEVV
EEVVPEEVIEEVIIEEVVEEVVPEEVIEEVITEEVVEEAIPEELVEEVIPEVLVEEEIPEELVEEVILEELVEEVVAEEL
IEEVVEEVIPEKLVEEVIPEEIVEEVIPEELVEVVVPEELVEEVIPEELVEEVIHEELVEEVIPEELVEEVIHEEIVEEV
IPEEVVEEVIPEEIVEEVVPEELLEEVIPELLVEEVVPEVVEEVVPVELLEEVVEEVITEEVIPEELIKEVISEELVEEL
IPEEVVQEVITEEVLEEVIPEEIVEELIPEKLIGEVVPEKVVEEVVLEEVVEEVIPEEIVEEVITEEVLAEEIVEEFVPE
ELVEEMLPEEVVEERVREVEIEEMVPEVLVEEVLPEVVEEVITEEVVEEMVPEEVVEEMVPKEIVEEVLPEEVVEEVIPE
EVVEEMVPEVLVEEVVPEEIVEKVVPEEVVEEVVAEEIIEEVITEEVVEEIVPGEVVEEMVPEEIIEEVVPEEVIEEVIT
EEVVEEVIPEELVEEVIPEISVEVEIPEVLVEEVIPEKLVKVVPEELVEEVIPEELVEEVITEALVEEVVDVVVPEEIFE
EVLPEEVVEEVIPEEVVEEMVPEEVVEEVVPEELVEEVIPEEVVEKVVPEQLVEKVVPEELVEKVLPEELVEEVVPEELI
EEVVTEEVIEEIIPEEIIEEIIPEEVVEERVSIEVVEELVPEELIEEVVAEEIFEEVVPEKLIEEVVAEELIEEMVPEVV
EEVVEEIIPEEVIEEVIPEEIREEIIPEEVVEEVIEEVIPEELIEEEISREIVEEVIPEEVVEEMMPEEVIEEVIPEEIR
EEMIPEEVVEEMIPEIEIEQVLPEELIEELVPEVEIEEILPEELIEELVPEGVIEEVIPKELIEEVIPEELIKEVVPEEV
VEEVIPKEIVEEVVPEELIEEVIPEELIEEVVPEEMIEEVIPEELIEEVVPEEMIEEVIPEELIEEVVPEEVKEEVIPVE
LIEEVVPEEMIEEVISEEVVEEVIPEELVEEVLPEVFVEEIVPKELVEEVIPEEIVEEVIPEELVEEVIPEELVEEVISE
ELLEEVIPELLVEEVVPEVIEEVVPEVVEEVIPEVVEEVVTEELVEEVIPEEVVEEMIPGVEIEEVLPEELVEEVIPEEI
VEEVISEEDFEEVIPEALVEEVIPELLVEEVVLEELIEEVIPEVVEEVIPEEVVEEVIPEEVVEKVVPEELVEEVIPEEL
VEEVIPEEVPEEVVPEELVEEVISEELVEEVIPEEIVEEVIPEEIVEEVMPEEVAEEVVPEELVEEEVPEELVEEVIPEV
LVEEVIPEEIVEEVVPEEVVEVVIPEEFIEEIIPEEVVVEVTPEELIEEMKPEELFEEVIPKELIEEIIPEELIKEVIPE
EIIEEVISKEIVEEVVEEEIIEEVIPEEIVEEVVPEELVEKKVPEEIVEEVIYEEFLEEIMPEELIEEMKPEELIEEIIP
REIVEEIITEEVVEEMKPEELVEEMVPEEVVEEMVPEEVVEEMVPEEVVEEVITEKLIEEVVPEEIIEELIPEELVEEVI
PEKLIEEMIPEEVVEEMLLEEVVEEVVPEVEIEEMIPEQLVEEVVPEELVEKEIPEVVEEIITEEVVEEMVPEEVVEEMV
PEEVVEEVILEKLIEEVVPVEVIEEVVPEEVIEEVIPEKLIEEIIPEVLVEEVVPEELIEEVIPEVLFEEVVPEVVEEVV
PEELVEKVVPEEIVEEVIPEFVEEVISEEIVEEVVTEELIEEMIPEEVVEEVIPEELVEEVVPVELIEEVVPVELLEEVI
PEELVEEVVPVELIEEVVPVELLEEVIPEEVVEEVIPEVVKEVVPEVVEEVVPEVVEEVVPEVVEEVVPEVVEEVVPEEL
IEEVIPEELIKEVLPEEVIEELKPEELIEEIIPEEVVEEVIPEELIEEMIPELLVEEEVPEELVEEVIPEVLVEEMVPEE
IVEEVIPEELIAEFAPEELFEKVIPEEVVEELVSEELVEEVLPEVVEEVLPEVFEEVIPEEVIEEIVPEEVMEEVVPKEL
IEEVIPEELIEEVIPEEVAEEVVPEKLIEEVIPEELIKEVVPEELIEEVITEEVVEEAISEELVEEVVPEEVVEEVIPEE
LIEEVVPEELIEEIIPEELVEEVIPEELVEEVVPEELVEEVIPEELVEEVVPEELVEKLIPEELVEEVIPELLVEEVVPE
EVVEELIPEELVEEVIPEELVEEVIPEEVPEEVIREELVEEVIPEELVEEVIPEEVPEEVVPEELVQEVIPEELVEEVVH
EEVPEEVVPEKLVEEVIPEELFEEVVPEEVPEEVVPEELVEEVISEELVEEVIPEELVEEFIPEELVEEVIPEELVEEVI
PEELVEEFIPEELVEEVIPEELVEEVIPEVLVEEEIPEKLVEEVVPEELVEEVIPEVLVEEVVTEEVPEEVVPEELVAEV
VPEELVKEVIPEELVEEVIPEEIVEEVIPEEVVEEVVPEELVEEVIPEEVVEEVIPEELVEEVVPVELVEEVVPEELVEE
VIPEELVEEVIPEEIVEEVIPEEVVEEVIPEEIVEEVISEELIEEVVPVELLEEVVPVEVLEDVIPEEVVEEVIPEEFIE
EMIPEEIIEEAIPEEIVEEVIPEVVEEVVPEELVEEVIPEEVVEKVVPEELVEEVIPEELVEEVIPEEVPEEVVPEELVE
EVISEELVEEIIPEELVEEVIPEEVVEEVVPEELVEEVIPEELVEEVIPEELVEEVIPEVVEEVIPEKLVEEVVPEELIE
EMIPEEIVEEVVPEVVEEVIPEELIEEVIPEELVEEVIPEKLIEEMIPEELVEEVILEEVVEEVIPEEVVEEVLPEELVE
EVVPEELVEEVAPVELLEEVIPEELLEEVIPEELVEEVIPEELVEDVIPEELVEEVIPEELVEEIIPEELVEEVIPEVLV
EEEVPEELVEEVIPEELVEEVIPEELVEELIPEVLEEVIPEKLVEEVVPVELLEEVIPEELIEEVVPEVLVEVIPEKVVE
EVIHEEIVKEVVPEELVEEVVPEEIVEEVVPEEVLEEVIPKVLLEEEIPEKLVEEVIPEELIEEVVPEELVEEVMPEEVV
EEVVPEELVEEVIPEEVVEEVIPEELVEEVVPVELLEEIVPVELLEEVIPEELVEEVIPEELVEEVVPEELVAEVIPEKL
VEEVIPEKLVEEVIPEELVEEVVPEELVAEVIPEKLVEEVIPEELVEEIIPEELVEEVVPEELVEEVVPEELVEEVIPEE
LVEEVIPEVLVEEEVPEELVEEVIPEELVEEMLPEELIEVVVPEELVEEVVPEELVEEVVPEEVVEEVIPEELIEELVPE
VEIEEILPEELIEELVPEEIIEEVIPKELIEEVIPEVVVEEVVPEVLVEEVVPEELVEEVIPEVLVEEEVPEELVEDVIP
EELVEEVVPEELVEEVIPEEVVEEVLPEELVEEVVPEEIVEEVIPEELVEEEVPEELVEEVIPEEVVEEVIPEEVPEKVI
PEKLVEELIPEEVVEELIPEEVVEEMVPIEVVEEVVPTEVLEEVIPEIVVEEVVPEELVEEVIPEELVEEVIPEIVVEEV
VPEELVEEVIPEELVEEVVPEELVEEVVPEEIVEELLPKEIVEEVIYEEQVEEVIHEELVAEVIPEEVVEEVVPEVVEEV
VPEIVAEVIPEEVVEEVVPEVVEEVVPEVVEEVIPEEVVEEVIPEEFIEEMIPEEIVEEVVPEVVEEVIPEELVAEVIPE
ELVEEVIPEVLFEEEIPEVVVEEVVPEVVEEEIPEVVVEEVVPEVVEEVIPEEVVEELIPEEVVEEMVPIEIVEEVVPTE
VLEEVIPEIVVEEVVPEELVEEVIPEELVEEVVPEELVEEVVPEVVEEVVPEVVEEVVPEELVEEVIPEVVVEEVVPEEL
VEEVIPEELVEEIIPEEIVEEVIPEELIEEVVPEVLVEEVIPEELVEEVIPEELFEEVVPEELVAEVIPEEIVEEVIPEE
LIEEFVPEELVEEEVPEELVEEVIPEVLVEEVIPEEFVEEVIPEEIVEEVIPEEIVEEVIPEEVVEEVVPEIVAEVIPEE
VVEEVVPEVVEEVVPEVIEEVVPEVIEEVVPEVVEEVVPEVVEEVVPEVVEEVVPVEVLEEVIPEEVVEEVIPEEFIEEM
IPEEIVEEVVPEVVEDVIPEELIAEVVSEELFEEEIPEELVEVVPVELLEEVIPEELVEEVIPEELVEEVVPEELVEEVV
PEELVEEVIPEELFEEVVPEELVEEVIPEEIVEEVIPEELIEEFVPEELVEEEVPEELVEEVIPEVLVEEVIPEEFVEEV
IPEELVEEVIPEELFEEVVPEELVEEVIPEEIVEEVIPEELIEEVVPEVLVEEVIPEELVEEVIPEELFEEVVPEELVAE
VIPEEIVEEVIPEELIEEFVPEELVEEEVPEELVEEVIPEVLVEEEVPEELVEEVIPEELVEEMLPEELIEVVVPEELVE
EVVPEIVEEVVPEELVEEVIPEEVVEEVLPEKLVEEVVPEIVEEVAPEVVEEVIPEELVEEIIPEILVEEVVPIEVVEEA
VPEVVVEEVVPEKIVEEVVPEKVLEEVIPELLVEEIVPIEVVGEIVPEEVVEKIVPMEVVEELLPEVVEEVPHEIVEEEV
VKEVIPEDEKKVEIVEIIIEEKVEKIPKKKVIEKKKEKEKIRKPKKKVEKEIKPKEVKGVKGKLKKDVKAKHLKGSKVKI
TEDIQKKMEDDIKEKIMEKELKEEIKDKEYLRKVIPKEEKKEPIPKKGKSVEPKKEKQAGVKKEKVPETKKEKAPAPKKE
KVQAPKKEKVPAPKKEKPAVPKKEKVPEPKKEKVPEPKKEKAPAPKKEKVQAPKKEKAPAPKKEKAPAPKKEKAPAPKKE
KAPAPKKEKPAVPKKEKPAVPKKEKVPETKKEKVPETKKEKVPETKKEKVPVPKKEKVPAPKKEKVPAPKKEKVPAPKKE
KPAVPKKEKVPETKKEKAPEPKKEKAPEPKKEKAPEPKKEKAPEPKKEKAPAPKKEKVPVPKKEKVPAPKKEKVPAPKKE
KPAVPKKEKVPETKKEKEKDSQPKKEKAKETSRPPKKEKEKGK

Gene-Specific Links for PF10_0374

General Sub-Cellular Localisation Links