ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0363 (PyKII)

pyruvate kinase 2, putative, a gene from Plasmodium falciparum

Compiled localisation
apicoplast and not mitochondrion during intraerythrocytic

Who localised this protein by microscopy?

Maeda, T., Saito, T., Harb, O. S., Roos, D. S., Takeo, S., Suzuki, H., Tsuboi, T., Takeuchi, T., Asai, T.
Pyruvate kinase type-II isozyme in Plasmodium falciparum localizes to the apicoplast. (2009 Mar, Parasitol Int) PubMed / full text
   more detail about this publication

apicoplast and not mitochondrion during intraerythrocytic
  • "Fluorescent microscopic analysis revealed that P. falciparum type-II enzyme was localized only to the apicoplast, not to the mitochondrion."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: Taken directly from paper
  • Localisation record: apicoplast and not mitochondria during asexual
  • Comment: strain information not found
  • Other genes localised in this publication: citrate synthase, mitochondrial precursor, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_25260

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF10_0363 pyruvate kinase 2, putative
MNLIHICLFIIVIKCYVNCIKKNNKHIAYDKFYKQGSNTIVGSGNGSGDLLFLNNININKNVERKKNILAHSEIGTVRNI
DDINLLNHNKKNEISFTKCKQIATIGPASENFEQLEKLYLNGIDVFRLNFSHGLKSIKKYIINSIRILEKKYDTTIGILG
DIQGPKIRIGEFEKNQINENDNNTFVELKEGDLFSFDLMNSLGNQNRVQLNYPELIKNAKAGQIILLDDGNLKMKILENN
YDTSNIQNSYIKVQVLTGGKLYSKKGFCIPNMIMPIDVLSEKDIKDILFCINEEVDFLGYSFVQTEYDLIFLRNIINDYY
ESDFYNNIKRKDRINFDQNNLQMKTFDDENDFYIKEVNDYYNNYYLKNVQKYKQIYDVYKNQDLYINDNIQNHYNKNIVT
NIGDDKNIIDEQHIHNNNNNNIDNIMKNYSNLYNINKDHNKIAIISKIEKPSAIKNIENIIKLSDGIMIARGDLGIETNL
SNLPILQKKLINLCRIKYNKPVIVATQMMESMRFLPSPTRAEVTDVATALYDGSDCVMLSAETATGQYPILTVSTQNKII
KDVENDYYYYEYTQRKNDKLKMLDHKNNCCHENKDIQQINKYNHEYIQNNKYEQDIQNNISYFDKLIFSIRDISNNINLK
SIILFSNEFNKIQKLSNLRTKAPIIVITENKYLARKLQLTWGIYPHLSKKQNLFNHDLFSLINYGCDVSKKEGFVNSPDE
YSLVTFSKNINSANLLYLCQPCLTN

Gene-Specific Links for PF10_0363

General Sub-Cellular Localisation Links