ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0356 (LSA-1)

liver stage antigen 1, a gene from Plasmodium falciparum

Compiled localisation
parasitophorous vacuole during hepatocyte stage day 3 and hepatocyte stage day 5
not cytoplasm and not parasite plasma membrane during hepatocyte stage day 3 and hepatocyte stage day 5 and hepatocyte stage day 7
around cytomeres during hepatocyte stage day 7
during not intraerythrocytic and not sporozoite

Who localised this protein by microscopy?

Fidock, D. A., Gras-Masse, H., Lepers, J. P., Brahimi, K., Benmohamed, L., Mellouk, S., Guerin-Marchand, C., Londono, A., Raharimalala, L., Meis, J. F., et, a. l. ..
Plasmodium falciparum liver stage antigen-1 is well conserved and contains potent B and T cell determinants. (1994 Jul 1, J Immunol) PubMed / full text
   more detail about this publication

parasitophorous vacuole during hepatocyte stage day 3 and hepatocyte stage day 5, not cytoplasm and not parasite plasma membrane during hepatocyte stage day 3 and hepatocyte stage day 5 and hepatocyte stage day 7, around cytomeres during hepatocyte stage day 7, during not intraerythrocytic and not sporozoite
  • "Initially, in day 3 (i.e., four- to eight-nuclei stage) and small day 5 forms (Fig. 3, a and b, respectively), the LSA-1 protein is located in the parasitophorous vacuole (PV) space, which is delineated by the inner plasmalemma and the outer PV membrane (PVM) and which forms a distinct ring separating the parasite cytoplasm from the host hepatocyte. At a later stage, the Ag appears also to infiltrate the spaces between the pseudocytomeres of the developing schizonts, as the plasmalemma forms deep invaginations into the parasite cytoplasm (Fig. 3c), and is subsequently seen localized around the cytomeres, just before the individualization of merozoites (Fig. 34. The ultrastructural localization of LSA-1 was revealed by immunogold labeling of fully mature forms, which showed this protein to be associated with the fluffy or flocculent material present in the PV that surrounds the emerging exo-erythrocytic merozoites (Fig. 3e). These Abs were repeatedly negative, by IFAT and Western analysis, on both blood stage and sporozoites."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: NF54
  • Gene model mapping comments: Blast from Z30319, annotation matches, blast from Z30320
  • Localisation record: PV and not parasite cytoplasm and not surface during hepatocyte stage day 3 and hepatocyte stage day 5, around cytomeres and not cytoplasm and not surface during hepatocyte stage day 7, not during asexual and sporozoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_33463

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF10_0356 liver stage antigen 1
MKHILYISFYFILVNLLIFHINGKIIKNSEKDEIIKSNLRSGSSNSRNRINEEKHEKKHVLSHNSYEKTKNNENNKFFDK
DKELTMSNVKNVSQTNFKSLLRNLGVSENIFLKENKLNKEGKLIEHIINDDDDKKKYIKGQDENRQEDLEQERLAKEKLQ
EQQSDLEQERXAKEKLQEQQSDLEQERLAKEKLQEQQSDLEQERLAKEKLQEQQSDLEQERRAKEKLQEQQSDLERTRDL
LKKSCKSSKAIEQERRAKEKLQEQQSDLEQERLAKEKLQEQQSDLEQERLAKEKLQEQQSDLEQERLAKEKLQEQQSDLE
QERLAKEKLQEQQSDLEQERLAKEKLQEQQSDLEQDRLAKEKLQEQQSDLEQERLAKEKLQEQQSDLEQERRAKEKLQEQ
QSDLEQERRAKEKLQEQQSDLEQERRAKEKLQEQQSDLEQERRAKEKLQEQQSDLEQERLAKEKLQEQQSDLEQERRAKE
KLQEQQSDLEQERLAKEKLQEQQSDLEQERRAKEKLQEQQSDLEQERRAKEKLQEQQSDLEQDRLAKEKLQEQQSDLEQE
RRAKEKLQEQQSDLERTKASTETLHEQQSDLEQERLAKEKLQEQQSDLEQERLAKEKLQEQQSDLERTKASTETLREQQS
DLEQEKLAKEKLQGQQSDLEQERLAKEKLQGQQSDLEQERLAKEKLQGQQSDLEQERLAKEKLQGQQSDLEQERLAKEKL
QERQSDLEQERLAKEKLQEQQSDLEQERLAKEKLQEQQSDLEQDRLAKEKLQEQQSDLEQERLAKEKLQGQHSDLERTKA
SKETLQEQQSDLEQERLAKEKLQEQQSDLEQERRAKEKLQEQQSDLEQERRAKEKLQEQQSDLEQERRAKEKLQEQQRDL
EQRKADTKKNLERKKEHGDVLAEDLYGRLEIPAIELPSENERGYYIPHQSSLPQDNRGNSRDSKEISIIENTNRESITTN
VEGRRDIHKGHLEEKKDGSIKPEQKEDKSADIQNHTLETVNISDVNDFQISKYEDEISAEYDDSLIDEEEDDEDLDEFKP
IVQYDNFQDEENIGIYKELEDLIEKNENLDDLDEGIEKSSEELSEEKIKKGKKYEKTKDNNFKPNDKSLYDEHIKKYKND
KQVNKEKEKFIKSLFHIFDGDNEILQIVDELSEDITKYFMKL

Gene-Specific Links for PF10_0356

General Sub-Cellular Localisation Links