ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0355 (MSP3.8)

merozoite surface protein, a gene from Plasmodium falciparum

Compiled localisation
merozoite surface during late schizont

Who localised this protein by microscopy?

Singh, S., Soe, S., Weisman, S., Barnwell, J. W., Perignon, J. L., Druilhe, P.
A conserved multi-gene family induces cross-reactive antibodies effective in defense against Plasmodium falciparum. (2009, PLoS One) PubMed / full text
   more detail about this publication

merozoite surface during late schizont

Orthology

OrthoMCL

Part of OrthoMCL group OG4_47573

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF10_0355 merozoite surface protein
MIYILSIVFYIFFLHIDIYVNIYSTCFVVNEGNPNLRNNIINDDELKGKAYNNTIDANNQNIEYNKNLKHNVNSSHISKF
SDIMDQEDKGDNENSHDIKFEEKKNINKSLDAESNYGINEISITGNDSNSDNSNQNIFPDGSELAGGIPRSIYTINLGFN
KCPTEEICKDFSNLPQCRKNVHERNNWLGSSVKNFSSDNKGVLVPPRRQSLCLRITLQDFRTKKKKEGDFEKFIYSYASS
EARKLRTIHNNNLEKAHQAIRYSFADIGNIIRGDDMMDTPTSKETITYLEKVLKIYNENNDKPKDAKKWWTENRHHVWEA
MMCGYQSAQKDNQCTGYGNIDDIPQFLRWFREWGTYVCEESEKNMNTLKAVCFPKQPRTEANPALTVHENEMCSSTLKKY
EEWYNKRKTEWTEQSIKYNNDKINYTDIKTLSPSEYLIEKCPECKCTKKNLQDVFELTFDGKALLEKLKKEESPVSNSVN
ALPEPGQITLPDPSLKQTTQQENQPVVETPVTTAVINEHQGQTEPNKGDNNNERENHESNVGSIQEVNQGSVSEESHSKT
IDPSKIDDRLELSSGSSSLEQHSKEDVKKGCALELVPLSLSDIEQIANESEDVLEEIEEEINTDGEIEYITEEEIKEDIE
EETEEDIEEETEEETEEETEEEADEETVKEIEDKPEQEIKNKSLEEKQIDKNTDTSEKKGFNNSEKDEKARNLISKNYKN
YNELDKNVHTLVNSIISLLEEGNGSDSTLNSLSKDITNLFKN

Gene-Specific Links for PF10_0355

General Sub-Cellular Localisation Links