ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0350 (MSP3.4)

probable protein, unknown function, a gene from Plasmodium falciparum

Compiled localisation
merozoite surface during late schizont

Who localised this protein by microscopy?

Singh, S., Soe, S., Weisman, S., Barnwell, J. W., Perignon, J. L., Druilhe, P.
A conserved multi-gene family induces cross-reactive antibodies effective in defense against Plasmodium falciparum. (2009, PLoS One) PubMed / full text
   more detail about this publication

merozoite surface during late schizont

Orthology

OrthoMCL

Part of OrthoMCL group OG4_25957

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • MAL7P1.171 Plasmodium exported protein, unknown function
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF10_0350 probable protein, unknown function
MKYILSISLFLILLNLYKCASISCEIDYTPSTNITSNLNSNLRSCSSNLVLSSNIDSTKLEGTYGENLNDSVSLTNNIND
HTTNESNISNVSNISNESNISNESSITNQSNLSSETNISSETNISNESSVPNESSVNEVPQLEVPKDAVENHTESKDVLL
NEKENFANGVETHVDLGSQEQYFGSSYDMNMDTEGGIKKFKNVFQSYFNQSKGNSGTEGDGSSVFGSIFGSLLTPIDSLL
EKFIGSNNTNSDSNVKNTSMGNGQNKYDNNIYLDEEDALSDAEHYNDGSISLGEEDELSDAEHYNDGSISLDEEDELSDA
EHYNDGGICLGEEDELSDAEHYNDGGISLDEEDVLSDAEHYNDGDISLDEDELSDTENYYDGGISLDESDDLSDPESKTK
EDNYHLYYWDDFYHEYKPTYLNYHMHYTLYEPNNFYDTTNEETHNFYNTTNEESHNFYNPTHEESHNFYNPTHEESHNFY
NPTHEESHNFYNPTHEESHNFYNPTHEESHNFYNPTHEESHNFYNPTHEESHNFYNPTHEESHNFYNPTHEESHNFYNPT
HEESHNFYNPTHEESHNFYTPTHEESHNFYNPTHEESHNFYNPTHEESHNFYNPTHEESHNFYNPTHEESHNFYNPTHEE
SHNFYTPTHDEFNVPLNYNHDYDYNYFENDNYNIQNVKDNLVKKVNDFMESDNLLVNTFKGIAGGVTSFFGY

Gene-Specific Links for PF10_0350

General Sub-Cellular Localisation Links