ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0348 (DBLMSP, MSP3.7, H103)

duffy binding-like merozoite surface protein, a gene from Plasmodium falciparum

Compiled localisation
merozoite surface during extracellular merozoite and late schizont and merozoite
not microneme during merozoite
parasite plasma membrane during early schizont and schizont

Who localised this protein by microscopy?

Hu, G., Cabrera, A., Kono, M., Mok, S., Chaal, B. K., Haase, S., Engelberg, K., Cheemadan, S., Spielmann, T., Preiser, P. R., Gilberger, T. W., Bozdech, Z.
Transcriptional profiling of growth perturbations of the human malaria parasite Plasmodium falciparum. (2010 Jan, Nat Biotechnol) PubMed / full text
   more detail about this publication

merozoite surface during extracellular merozoite and late schizont

Singh, S., Soe, S., Weisman, S., Barnwell, J. W., Perignon, J. L., Druilhe, P.
A conserved multi-gene family induces cross-reactive antibodies effective in defense against Plasmodium falciparum. (2009, PLoS One) PubMed / full text
   more detail about this publication

merozoite surface during late schizont

Wickramarachchi, T., Cabrera, A. L., Sinha, D., Dhawan, S., Chandran, T., Devi, Y. S., Kono, M., Spielmann, T., Gilberger, T. W., Chauhan, V. S., Mohmmed, A.
A novel Plasmodium falciparum erythrocyte binding protein associated with the merozoite surface, PfDBLMSP. (2009 Jun, Int J Parasitol) PubMed / full text
   more detail about this publication

merozoite surface and not microneme during merozoite, parasite plasma membrane during early schizont and schizont
  • "PfDBLMSP was localized on the merozoite surface with a GFP targeting approach using schizont-stage specific expression systems, and by immunofluorescence assays of the endogenous protein."
  • Microscopy type: Light, EM
  • Microscopy method: N terminal GFP, C terminal GFP, polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: merozoite surface and not microneme during merozoite, plasma membrane during early schizont and schizont
  • Comment: PMID is also 19640465
  • Comment: N terminal GFP tag is after predicted signal peptide
  • Other genes localised in this publication: merozoite surface protein 1, erythrocyte binding antigen-175

Orthology

OrthoMCL

Part of OrthoMCL group OG4_47573

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF10_0348 duffy binding-like merozoite surface protein
MKKIYSIFFSLFILNLHIYIKNIKCNDLINYNDSNLRNGLLNNSLDLTNGLNNKDNSFIDSKIEEHENKSYQNKDNNISI
VGQDVPITSVYSSKIINANDLEGNSIDDTKGLSVTNSGFDDGSAFGGGLPFSGYSPLQGNHNKCPDENFCKGIKNVLSCP
PKNSTGRNGDWISVAVKESSTTNKGVLVPPRRTKLCLRNINKVWHRIKDEKNFKEEFVKVALGESNALMKHYKEKNLNAL
TAIKYGFSDMGDIIKGTDLIDYQITKNINRALDKILRNETSNDKIKKRVDWWEANKSAFWDAFMCGYKVHIGNKPCPEHD
NMDRIPQYLRWFREWGTYVCSEYKNKFEDVIKLCNIQQFTNQDDSQLLEISKKDKCKEALKHYEEWVNRRRPEWKGQCDK
FEKEKSKYEDTKSITAEKYLKEICSECDCKYKDLDNTFKEFKDNVTLLKAVIDNKKNQDSLTTTSLSTSINSVRDSSNLD
QRGNITTSQGNSHRATVVQQVDQTNRLDNVNSVTQRGNNNYNNNLERGLGSGALPGTNIITEEKYSLELIKLTSKDEEDI
IKHNEDVREEIEEQQEDIEEDEEELENEGEETKEEDDEEKNETNDTEDTDDTEDTEDIEEENKEKELSNQQQSEKKSISK
VDEDSYRILSVSYKDNNEVKNVAESIVKKLFSLFNDNNNLETIFKGLTEDMTDLFQK

Gene-Specific Links for PF10_0348

General Sub-Cellular Localisation Links