ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0346 (MSP-6 36, MSP3.2, MSP6)

merozoite surface protein 6, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during late schizont and merozoite
merozoite surface during late schizont

Who localised this protein by microscopy?

Singh, S., Soe, S., Weisman, S., Barnwell, J. W., Perignon, J. L., Druilhe, P.
A conserved multi-gene family induces cross-reactive antibodies effective in defense against Plasmodium falciparum. (2009, PLoS One) PubMed / full text
   more detail about this publication

merozoite surface during late schizont

Kadekoppala, M., O'Donnell, R. A., Grainger, M., Crabb, B. S., Holder, A. A.
Deletion of the Plasmodium falciparum merozoite surface protein 7 gene impairs parasite invasion of erythrocytes. (2008 Dec, Eukaryot Cell) PubMed / full text
   more detail about this publication

parasite plasma membrane during late schizont
  • "Absence of MSP7 does not alter expression and distribution of several other peripheral merozoite surface proteins. In addition to MSP7, several other proteins have been reported to interact with the MSP1 complex through protein-protein interactions. We investigated expression and distribution of MSP3, MSP6, and MSP9 (ABRA) and a parasitophorous vacuolar protein, SERA-5, in order to examine the consequence of altering the nature of the MSP1 complex."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: D10
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during late schizont
  • Other genes localised in this publication: merozoite surface protein 1, merozoite surface protein 3, merozoite surface protein 9, serine repeat antigen 5

Trucco, C., Fernandez-Reyes, D., Howell, S., Stafford, W. H., Scott-Finnigan, T. J., Grainger, M., Ogun, S. A., Taylor, W. R., Holder, A. A.
The merozoite surface protein 6 gene codes for a 36 kDa protein associated with the Plasmodium falciparum merozoite surface protein-1 complex. (2001 Jan 15, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane during merozoite
  • "MSP-636 is both located on the surface of the parasite in association with MSP-1 and present as a soluble protein"
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: T9/96
  • Gene model mapping comments: Blast from AY007721, annotation matches
  • Localisation record: surface during merozoite
  • Other genes localised in this publication: merozoite surface protein 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_47573

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF10_0346 merozoite surface protein 6
MNKIYNITFLFILLNLYINENNFIRNELINEKNHNLRNGSMYNNDKILSKNEVDTNIESNENSIHESGHKIDGEEVLKAN
VDDITYKKKNVDDSEIPFSGYDIQATYQFPSTSGGNNVIPLPIKQSGENQYTVTSISGIQKGANGLTGATENITQVVQAN
SETNKNPTSHSNSTTTSLNNNILGWEFGGGAPQNGAAEDKKTEYLLEQIKIPSWDRNNIPDENEQVIEDPQEDNKDEDED
EETETENLETEDDNNEEIEENEEDDIDEESVEEKEEEEEKKEEEEKKEEKKEEKKPDNEITNEVKEEQKYSSPSDINAQN
LISNKNKKNDETKKTAENIVKTLVGLFNEKNEIDSTINNLVQEMIHLFSNN

Gene-Specific Links for PF10_0346

General Sub-Cellular Localisation Links