ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0344 (GLURP) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

glutamate-rich protein, a gene from Plasmodium falciparum

Compiled localisation
parasitophorous vacuole during hepatocyte schizont and schizont
merozoite surface during merozoite
erythrocyte cytoplasm adjacent to the parasitophorous vacuole during gametocyte

Who localised this protein by microscopy?

Borre, M. B., Dziegiel, M., Hogh, B., Petersen, E., Rieneck, K., Riley, E., Meis, J. F., Aikawa, M., Nakamura, K., Harada, M., et, a. l. ..
Primary structure and localization of a conserved immunogenic Plasmodium falciparum glutamate rich protein (GLURP) expressed in both the preerythrocytic and erythrocytic stages of the vertebrate life cycle. (1991 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

parasitophorous vacuole during hepatocyte schizont and schizont, merozoite surface during merozoite, erythrocyte cytoplasm adjacent to the parasitophorous vacuole during gametocyte
  • "Antibodies against GLURP stained erythrocytic stages of the parasite as well as the hepatic stage as detected by electron microscopy."
  • Microscopy type: EM
  • Microscopy method: antibody
  • Strain: NF54
  • Gene model mapping comments: Blast from M59706, gene model inconsistent
  • Localisation record: PV during liver schizont and erythrocytic schizont, merozoite surface during newly released merozoites, erythrocyte cytoplasm adjacent to the parasitophorous vacuole during gametocyte
  • Other genes localised in this publication: -

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PF10_0344 glutamate-rich protein
MRNLFHITICLVTLNLFILEINAKTNTSENRNKRIGGPKLRGNVTSNIKFPSDNKGKIIRGSNDKLNKNSEDVLEQSEKS
LVSENVPSGLDIDDIPKESIFIQEDQEGQTHSELNPETSEHSKDLNNNDSKNESSDIISVNNKSNKVQNHFESLSDLELL
ENSSQDNLDKDTISTEPFPNQKHKDLQQDLNDEPLEPFPTQIHKDYKEKNLINEEDSEPFPRQKHKKVDNHNEEKNVFHE
NGSANGNQGSLKLKSFDEHLKDEKIENEPLVHENLSIPNDPIEQILNQPEQETNIQEQLYNEKQNVEEKQNSQIPSLDLK
EPTNEDILPNHNPLENIKQSESEINHVQDHALPKENIIDKLDNQKEHIDQSQHNINVLQENNINNHQLEPQEKPNIESFE
PKNIDSEIILPENVETEEIIDDVPSPKHSNHETFEEETSESEHEEAVSEKNAHETVEHEETVSQESNPEKADNDGNVSQN
SNNELNENEFVESEKSEHEPAENEESSLEEGHHEEIVPEQNNEESGESKLVDNDEGGFEEAHHENFSSEVSNSELNENEF
VESDKSVTEPAEHEEVVSEESNPEPAENEESSIEEAHQEEIVPEQNDEESGESGLVDNEEGDFEEPNHEEFEPDQNDSEL
SENELVESEKSVSEPAEHVEIVSEKSVSEPAEHVEIVSEKSTSEPAEHVESVSEQSNNEPSEKKDGPVPSKPFEEIEKVD
VQPKIVDLQIIEPNFVDSQPNPQEPVEPSFVKIEKVPSEENKHASVDPEVKEKENVSEVVEEKQNSQESVEEIPVNEDEF
EDVHTEQLDLDHKTVDPEIVEVEEIPSELHENEVAHPEIVEIEEVFPEPNQNNEFQEINEDDKSAHIQHEIVEVEEILPE
DDKNEKVEHEIVEVEEILPEDKNEKVQHEIVEVEEILPEDKNEKVEHEIVEVEEILPEDKNEKGQHEIVEVEEILPEDKN
EKVQHEIVEVEEILPEDKNEKGQHEIVEVEEILPEDKNEKVEHEIVEVEEILPEDKNEKGQHEIVEVEEILPEDDKNEKG
QHEIVEVEEILPEIVEIEEVPSQTNNNENIETIKPEEKKNEFSVVEEKAIPQEPVVPTLNENENVTPKPSEGESTKPDIV
QIKIVQENKPNKKETPVVDGPKHVEQNIQEDDNDEEDDDDIDFEGLSRKDDEKDSSNKNKKKSSFITYISTKKFKKVSQT
IVSVMINAYDGVIQVVSTIKGIAKDIVIFFQNI

Gene-Specific Links for PF10_0344

General Sub-Cellular Localisation Links