ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0343 (S-antigen)

S-antigen, a gene from Plasmodium falciparum

Compiled localisation
parasitophorous vacuole during early schizont and schizont
cleft like parasitophorous vacuole membrane protrusion during schizont
around merozoite during after parasitophorous vacuole membrane breakdown
during not extracellular merozoite and not ring and not trophozoite
erythrocyte cytosol during late schizont

Who localised this protein by microscopy?

Wickham, M. E., Culvenor, J. G., Cowman, A. F.
Selective inhibition of a two-step egress of malaria parasites from the host erythrocyte. (2003 Sep 26, J Biol Chem) PubMed / full text
   more detail about this publication

parasitophorous vacuole during early schizont, erythrocyte cytosol during late schizont
  • "A, in untreated early schizonts, S-antigen localizes to the parasitophorous vacuole. B, in untreated late schizonts, S-antigen localizes throughout the erythrocyte cytosol."
  • Microscopy type: EM
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: parasitophorous vacuole during early schizont, throughout erythrocyte cytosol during late schizont
  • Other genes localised in this publication: knob-associated histidine-rich protein

Wilson, R. J., McGregor, I. A., Hall, P. J.
Persistence and recurrence of S-antigen in Plasmodium falciparum infections in man. (1975, Trans R Soc Trop Med Hyg) PubMed / full text
   more detail about this publication

cleft like parasitophorous vacuole membrane protrusion and parasitophorous vacuole during schizont, around merozoite during after parasitophorous vacuole membrane breakdown, during not extracellular merozoite and not ring and not trophozoite
  • "Labelling was found in the parasitophorous vacuole (PV) space of early to late schizonts and in PV-related vesicles within the erythrocyte cytoplasm of schizont-infected cells. Other subcellular structures within the erythrocyte cytoplasm were not labelled. After breakdown of the PV membrane, label was observed around the merozoites, consistent with mixing of the PV contents and erythrocyte cytoplasm. The antigen was not found in uninfected cells, ring stages, trophozoites or associated with free merozoites."
  • Microscopy type: EM
  • Microscopy method: antibody
  • Strain: FCQ27/PNG
  • Gene model mapping comments: blast from AAA18803, annotation matches
  • Localisation record: PV and PV related structures in erythrocyte cytoplasm during schizont, around merozoite during after PVM breakdown, not during ring and troph and free merozoite
  • Comment: no fulltext available online
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_34531

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF10_0343 S-antigen
MNRILSVTLCLFFIYLYIYKTYGKVKNTDEGLSNIYGAKYYLRSGLFNEKNGKGQKYEDLEEEKEGENDDEEDSNSEESN
NDEENELIKGQEGVEQETHGSEDEVSNGREDKVSNGGEDEVSNGGEDEVSNGREDKVSNGGEDEVSNGREDKVSNGGEDE
VSNGREDKVSNGGEDEVSNGREDKVSNGGEDEVSNGREDKVSNGREDKVSNGGEDEVSNGREDKVSNGREDKVSNGGEDE
VSNGREDKVSNGGEDEVSNGREDKVSNGGEDEVSNGREDKVSNGREDEVSNGREDKVSNGGEDEVSNGREDKVSNGGEDE
VSNGREDKVSNGREDKVSNGGEDEVSNGREDKVSNGGEDEVSNGREDKVSNGREDKVSNGREDEVSNGREDKVSNGGEDE
VSNGREDKVSNGREDKVSNGGEDEVSNGREDKVSNGGEDEVSNGREDKVSNGREDKVSNGREDKVSNGGEDEVSNGGEDE
VSNGREDKVSNGGEDEVSNGREDKVSNGGEDEVSNGREDKVSNGGEDEVSNGREDKVSNGREDEVSNGREDKGGAGTDGE
LSHNSESHTKNKKSKNSIINMLIGM

Gene-Specific Links for PF10_0343

General Sub-Cellular Localisation Links