ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0321 ()

conserved Plasmodium protein, unknown function, a gene from Plasmodium falciparum

Compiled localisation
mitochondrion

Who localised this protein by microscopy?

Sargeant, T. J., Marti, M., Caler, E., Carlton, J. M., Simpson, K., Speed, T. P., Cowman, A. F.
Lineage-specific expansion of proteins exported to erythrocytes in malaria parasites. (2006, Genome Biol) PubMed / full text
   more detail about this publication

mitochondrion

Orthology

OrthoMCL

Part of OrthoMCL group OG4_25861

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF10_0321 conserved Plasmodium protein, unknown function
MLKHVFFCYRWRAEYGWVKSRLNFLCGASCYSSNINMDKIIDENKYEYIKNLRSQELRILSENCCVKKVDDVIIWSEICR
HSIEKYNSFKYFDALLLLSSFDKMNIVDKSLYKTFSDVFIKQISYLKPEHFILLINLYCRVNIFPRVLFTEIFHGIIKYC
NKLYPDEYVNLLTCFANLKIANKDLIKTLCKSIIKNINLFDYIHLTNIVGALRSLEITDDIFYYVIDQKQLKELKFLTVQ
EIFDFIKKIKLLQYSWKLYEQDLMKEFLFKVYNFKNEKDVDQLDDPFVCLNFLVSKGLLQGNNNTNIKKKNNNKKNNNNK
KNNNNKKNNNNNNDNNNDNNNNDNNNNNDNNNNNDNNNNNSSSDFIDDINCGGANFLVALSKWCANQVYHYPSRSTKRPT
SYQLIKLYELMKEFNIHNSDFIEKAIYRFVITRGGLENNRDKMFKPTSYQKGRKYIFTKDPQIDHINYEKNKEHSYSHHY
NLKDHTTDYEQQNMHYQTYDYNDEHNMNQQKTLSEKHKRIKLSMEKKTQNKKETHSNSRYCNFKLRQRPKRIKNSPAPIK
V

Gene-Specific Links for PF10_0321

General Sub-Cellular Localisation Links