ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0303 (Pfs25, P25)

25 kDa ookinete surface antigen precursor, a gene from Plasmodium falciparum

Compiled localisation
vesicle during emerged gametocyte and non-activated gametocyte
parasite plasma membrane during emerging gametocyte and gamete formation and ookinete

Who localised this protein by microscopy?

Scholz, S. M., Simon, N., Lavazec, C., Dude, M. A., Templeton, T. J., Pradel, G.
PfCCp proteins of Plasmodium falciparum: gametocyte-specific expression and role in complement-mediated inhibition of exflagellation. (2008 Mar, Int J Parasitol) PubMed / full text
   more detail about this publication

vesicle during emerged gametocyte and non-activated gametocyte, parasite plasma membrane during emerging gametocyte and gamete formation
  • "Pfs25, a surface protein of macrogametes, zygotes and ookinetes (Vermeulen et al., 1986), is also expressed at low levels within intracellular vesicles of both non-activated and activated mature gametocytes, before being relocated to the gametocyte surface during emergence (Fig. 3a; Fries et al., 1990). Pfs25, which is used as a marker for female gametocytes, is present in intracellular vesicles in stage IV and stage V gametocytes. Vesicular Pfs25 expression can be detected in both non-activated as well as activated gametocytes."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: NF54
  • Gene model mapping comments: inferred from another publication
  • Localisation record: vesicles during non-activated gametocyte and activated gametocyte, surface during gametocyte emergence and gamete formation
  • Other genes localised in this publication: LCCL domain-containing protein, LCCL domain-containing protein, LCCL domain-containing protein, LCCL domain-containing protein, LCCL domain-containing protein, LCCL-like protein

Pradel, G.
Proteins of the malaria parasite sexual stages: expression, function and potential for transmission blocking strategies. (2007 Dec, Parasitology) PubMed / full text
   more detail about this publication

parasite plasma membrane during ookinete
  • "A cluster of 3 zygotes, one of which is transforming into an ookinete, expressing Pfs25 on the surface (Pfs25 labelling shown in green, erythrocytes shown in red)"
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: Blast from AF193769, annotation matches
  • Localisation record: surface during ookinete
  • Comment: strain information not found
  • Other genes localised in this publication: 6-cysteine protein, LCCL domain-containing protein, alpha tubulin 2, LCCL domain-containing protein

Vermeulen, A. N., Ponnudurai, T., Beckers, P. J., Verhave, J. P., Smits, M. A., Meuwissen, J. H.
Sequential expression of antigens on sexual stages of Plasmodium falciparum accessible to transmission-blocking antibodies in the mosquito. (1985 Nov 1, J Exp Med) PubMed / full text
   more detail about this publication

parasite plasma membrane during ookinete
  • "A different antigen (Mr 25,000) surrounds the surface of the ookinete and, although present to some extent in the developing gametocyte, is synthesized in high quantities by the macrogamete/zygote and expressed progressively on the transforming zygote surface"
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: NF54
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during ookinete
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_33730

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PCHAS_051510 25 kDa ookinete surface antigen precursor, putative
  • PKH_061530 Ookinete surface protein Pvs25, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF10_0303 25 kDa ookinete surface antigen precursor
MNKLYSLFLFLFIQLSIKYNNAKVTVDTVCKRGFLIQMSGHLECKCENDLVLVNEETCEEKVLKCDEKTVNKPCGDFSKC
IKIDGNPVSYACKCNLGYDMVNNVCIPNECKNVTCGNGKCILDTSNPVKTGVCSCNIGKVPNVQDQNKCSKDGETKCSLK
CLKENETCKAVDGIYKCDCKDGFIIDNESSICTAFSAYNILNLSIMFILFSVCFFIM

Gene-Specific Links for PF10_0303

General Sub-Cellular Localisation Links