ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0295 ()

conserved Plasmodium protein, unknown function, a gene from Plasmodium falciparum

Compiled localisation
apical during extracellular merozoite and late schizont

Who localised this protein by microscopy?

Hu, G., Cabrera, A., Kono, M., Mok, S., Chaal, B. K., Haase, S., Engelberg, K., Cheemadan, S., Spielmann, T., Preiser, P. R., Gilberger, T. W., Bozdech, Z.
Transcriptional profiling of growth perturbations of the human malaria parasite Plasmodium falciparum. (2010 Jan, Nat Biotechnol) PubMed / full text
   more detail about this publication

apical during extracellular merozoite and late schizont

Orthology

OrthoMCL

Part of OrthoMCL group OG4_24476

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_051420 conserved Plasmodium protein, unknown function
  • PY04569 hypothetical protein
  • PVX_111215 hypothetical protein, conserved
  • PCHAS_051430 conserved Plasmodium protein, unknown function
  • PKH_061450 hypothetical protein, conserved in Apicomplexan species
  • TGME49_065790 hypothetical protein, conserved
  • NCLIV_039710 Multitransmembrane protein with signal peptide and GMGPP repeat at C-terminus, related
  • cgd4_2350 multitransmembrane protein with signal peptide and GMGPP repeat at C-terminus
  • Chro.40265 hypothetical protein
  • CMU_017330 hypothetical protein, conserved
  • TA07630 hypothetical protein, conserved
  • BBOV_II003100 hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF10_0295 conserved Plasmodium protein, unknown function
MARVRKGKAMPVMSKNSIFVLNIIMTIGFISAIPQIFTTLMTSWREAEPIEYKYMFRGSEHSLYVDYTYYGLYKVVYDNK
HVETWTQRVQNMKRKGIEGIQQGKNSESAGSLSLWTSVCPEACRDAIVRRIEAYERVSFISLVLLCGIVISCTIVILSVG
WNLLFSKSIFILMGCFIFSFVINAGIGTYWYYETDMSWNSITKAQQYPFPRCSHCFYVFMITTGIYALCFLSLLLLDLFN
KGKQKSSHRDQLNAHNRNPMNNKAMYQPMFDNQPGMMMQRSASYSNIMPFVKGMNNNDYSNYMQYNKMGMNMNMNMNQMP
QQGFPNFRNMGSNVGPNMGSPMGSPMGPSMGSPMGPSMGSPMGPNMGSPMSSPMGSHMGPNLNPNFFPQQSRQYSYSVSP
TYQQNMPNFNNFSNRHMPSMSDLYFARQYSGMKFGDMNNSPFDSQKPYKF

Gene-Specific Links for PF10_0295

General Sub-Cellular Localisation Links