ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0281 (MTRAP)

merozoite TRAP-like protein, a gene from Plasmodium falciparum

Compiled localisation
merozoite surface
microneme during schizont

Who localised this protein by microscopy?

Baum, J., Richard, D., Healer, J., Rug, M., Krnajski, Z., Gilberger, T. W., Green, J. L., Holder, A. A., Cowman, A. F.
A conserved molecular motor drives cell invasion and gliding motility across malaria life cycle stages and other apicomplexan parasites. (2006 Feb 24, J Biol Chem) PubMed / full text
   more detail about this publication

merozoite surface, microneme during schizont

Orthology

OrthoMCL

Part of OrthoMCL group OG4_50813

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF10_0281 merozoite TRAP-like protein
MKKTILNLYLINILFALSDVKGISTHDTCDEWSEWSACTHGISTRKCLSDSSIKDETLVCTKCDKWGEWSECKDGRMHRK
VLNCPFIKEEQECDVNNEMAEDTHMNNSYIYFNADDGDNEYEDHDDKNDDDKNYDNENDDDKNDDDKNDDDKNDDDKNDD
DKNDDEENYNDTEEKVKNNDIHNSSANSNNEVTNFIQIKDKIMIKHKTTNIHPVNFIQEKYTRNNKYRSDNFSKILNNMN
HINNNNYNSRSSSTSSKNARGYRGGSSNMYPHVPNYTSSSVHNSTNNERKSDEDLDNIEGDNITKEERIVPINNKNYDNH
DEHSNIHEHDTSRNVDNEKYNSNDDLPNLSTYDYDMNNDSYKKNHMKKPMDSIKEEQTKQENNQNNEKVSSSEKQNDDIS
ALYEHMNTKDQEHTQHEQPNDSAHGHFEDYSKLYIASGVATLVLLGGSITFYFLRKEKTEKVVQEETKEENFEVMFNDDA
LKGKDNKAMDEEEFWALE

Gene-Specific Links for PF10_0281

General Sub-Cellular Localisation Links