ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0275 (PPO)

protoporphyrinogen oxidase, a gene from Plasmodium falciparum

Compiled localisation
mitochondrion

Who localised this protein by microscopy?

Nagaraj, V. A., Arumugam, R., Prasad, D., Rangarajan, P. N., Padmanaban, G.
Protoporphyrinogen IX oxidase from Plasmodium falciparum is anaerobic and is localized to the mitochondrion. (2010 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

mitochondrion
  • "In the present study, PfPPO has been cloned, expressed and shown to be localized to the mitochondrion by immunofluorescence microscopy. "
  • Microscopy type: Fixed Light
  • Microscopy method: antibody to orthologue
  • Strain:
  • Gene model mapping comments: taken directly from publication
  • Localisation record: mitochondrion
  • Comment: strain information not found
  • Comment: stage information not found in publication
  • Other genes localised in this publication: porphobilinogen deaminase, heat shock protein 60

Orthology

OrthoMCL

Part of OrthoMCL group OG4_39829

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF10_0275 protoporphyrinogen oxidase
MSEYKKYNVPSHEIYDVILIGGGLFNCCLYYYLKLKNSELSIIIVEKEENLGGYIKTYTYNIDDKKILVELGPNMFKLCN
ESYNLINKLNLLSSVRLLDDTLIRYIYIKNDKLYPLYLNIFSYLSFPLINISNKIKLLFKLIFKQYKNLNSYTNDISVEN
YMNDNFDSQHYNFLLLPFIYGSCAGNGKISAVSFFSRNLKLFHNKVNSLYIWNEKIKSEEKNRNIKCVNNNTFIYQHMNK
KKKNFNLFTPCYNFFYISNKNMKMDVYLNVLYNYYSSNKKTEKKNVFNYICYRIPILLLHMKQFSINIFRHISIFLKCTY
QFFYPFLMLPDLAKWTTSHFDDEKKKKKNLIGKTVTFKNGLYELIDKLQSHMNKEFIYTNHEVDFIEKAYNNLWMCNIKH
ENQNKTIYGKNIVLAVNSKICSNIMRNILPVNIRDILLNFSYSSIISISLYFKKSDINIPKNFFGFLSSDKCAHILGCFH
INNMFKERCHDDNKVLLTLYMGGSNHPNDITLDEYEIKEIISNDLKNIFDIYNDAQPNILKIHKWKDAIPFYSYNYEKLL
KKVMEELNKLSYKNLYLDSGWITGTSISDRIRSAQDLCEYIFSLTNLAS

Gene-Specific Links for PF10_0275

General Sub-Cellular Localisation Links