ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0271 (CEN3)

centrin-3, a gene from Plasmodium falciparum

Compiled localisation
area near nucleus and nuclear membrane during schizont
during gametocyte and oocyst and schizont

Who localised this protein by microscopy?

Mahajan, B., Selvapandiyan, A., Gerald, N. J., Majam, V., Zheng, H., Wickramarachchi, T., Tiwari, J., Fujioka, H., Moch, J. K., Kumar, N., Aravind, L., Nakhasi, H. L., Kumar, S.
Centrins, cell cycle regulation proteins in human malaria parasite Plasmodium falciparum. (2008 Nov 14, J Biol Chem) PubMed / full text
   more detail about this publication

area near nucleus and nuclear membrane during schizont, during gametocyte and oocyst and schizont
  • "A careful three-dimensional visualization of the images confirmed that PfCEN3 reactivity is localized on the "outer" side and not "inside" of the central mass of the DAPI-stained DNA."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from paper
  • Localisation record: nuclear membrane and area near nucleus during schizont, during schizont and gametocyte and oocyst
  • Comment: gene model inconsistent has been corrected in PlasmoDB
  • Other genes localised in this publication: centrin-1, centrin-2, centrin-4, heat shock protein 70, alpha tubulin 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12791

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF10_0271 centrin-3
MINRKSESVSYTPRAITNRPISSNRRRGRNEITDEQKNEIKEAFDLFDTEKTGKIDYHELKVAIRALGFDIKKADVLDLM
REYDKTNSGHIDYNDFLDIMTQKISERDPTEEIIKAFKLFDDDDTGKISLKNLRRVSRELGENLSDDELQAMIDEFDKDM
DGEISQEEFLSIMKQTSLY

Gene-Specific Links for PF10_0271

General Sub-Cellular Localisation Links