ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0223 ()

conserved Plasmodium membrane protein, unknown function, a gene from Plasmodium falciparum

Compiled localisation
apical during extracellular merozoite and late schizont

Who localised this protein by microscopy?

Hu, G., Cabrera, A., Kono, M., Mok, S., Chaal, B. K., Haase, S., Engelberg, K., Cheemadan, S., Spielmann, T., Preiser, P. R., Gilberger, T. W., Bozdech, Z.
Transcriptional profiling of growth perturbations of the human malaria parasite Plasmodium falciparum. (2010 Jan, Nat Biotechnol) PubMed / full text
   more detail about this publication

apical during extracellular merozoite and late schizont

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48359

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF10_0223 conserved Plasmodium membrane protein, unknown function
MKMEDVEIKQALFKNENKMKGEKCTICKSKYGKFINAFLTWEIVLLIVHILIYLVIIYKFLKDGKLTSGNNMLFRSYYSA
GHFTQGFLFVLLLVPFHFKKRIVKYLINTSSVQMCNNGESEIKESFDDIEKHKINNYIQDGDKEEEEEEKKKKKSSEDIK
MMINKGNNTTDKNMDDELTAINSDLNELEKEKYLNDMNIGINNENKIEANDENITNSLSESFINKLVFCSNTPNHKKKEI
HYFFLCAKLFSLNRMNFLFVIKYVSTFILMFAYSLYNIIKRKLRYKYFYYSSYYMNSFDFAAGLLAGGIFVLLYGIIFFC
IKLYNNTIKNKNKNFHFYDNYPFINDVKCICDENIKLNIRNNPYLKNIAINYFNSYYNYKNLLLIGQMFLVIICIFSFIF
SITSIYAFELNRQ

Gene-Specific Links for PF10_0223

General Sub-Cellular Localisation Links