ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0177b ()

conserved Plasmodium protein, unknown function, a gene from Plasmodium falciparum

Compiled localisation
perinuclear during intraerythrocytic

Who localised this protein by microscopy?

van Ooij, C., Tamez, P., Bhattacharjee, S., Hiller, N. L., Harrison, T., Liolios, K., Kooij, T., Ramesar, J., Balu, B., Adams, J., Waters, A. P., Janse, C. J., Haldar, K.
The malaria secretome: from algorithms to essential function in blood stage infection. (2008 Jun, PLoS Pathog) PubMed / full text
   more detail about this publication

perinuclear during intraerythrocytic

Orthology

OrthoMCL

Part of OrthoMCL group OG4_23359

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF10_0177b conserved Plasmodium protein, unknown function
MDVQKKKCKTYYLIAILIWFILISVVLSRGEIINKHVKKKEGNYKNYEDLDSDINKKNNYYDDKHKNKRLLSDTNINNDN
NINNNNNINNDNNINNDNNINNDNNINNDNNINNDNNINNDNNINNDNNINNDNNINNDNINNNNNNNSLYNNNSFYNNN
SFYNNNSLYNNNYLYNNYTHPKQQDGHKNHPEENKNYTYDDKTKFTKFNKHKNEELFTPNPPLNYEKQTLSNHQNINFDS
TVEEGNKDLNNSGNIISQELEKKLSTDNHKEEGERKKEETNKKHDIDTNNMDDNEEKNIYEYFNKKTKDNFDGLILNIYF
TPNNNLYTKVKVGDQVLKLSLNSRLEGVYVFMKDSPACYLEDDDKRTCYNPLMSRNSTWCNNDLMCLPAILTKPYECYED
SSLNLENKVQYPNVYYDSLKFNETHIEGSDDLEFIDLVGVQTKYIRNKKKKMDVNKMMSNENKSMDPKHVENNLQNNNIL
KRDNIIIKPRVKLSENSNLLFQGVDIKLVVDMTFYNDWNLFKDTDGMFGLAGKELSCRNISAWNNILENNNSIFALDINL
PNDAIKTYPTPPVNSVGTLYYEYDLKKNGDNKKSSDQNINNVKDNMIDNKNVDVGVQNINEFETSSSVIHIGNYSKEYGN
IIWSEPRERGGIFSDSFIQFTIYNLEVCNKNIFGKYSSNWQAIIDLSSQCLVLPKMFWLSLMEYLPVNKDDDRCIRKNMN
PNNNNNNNKNNDNNNNNNKNNDNNNNNNKNNDNNNNNNKNNDNNNNNNKNNDNNNNNNKNNDNNNNNNKNNDNNNGDNVD
YEENSLPRMCSVDHRNRPLPTLKFFLSDNDIVSDNNIYSSPESENKGKNEKKNEKQAIYIPLDNLIINDKKNNQNYLCVI
PDVHDGRSTENSARTTKPLIKFGTYVLNNFYVVVDQENYKVGFANKKSFHTSNEKCTQRTQCIGDQYYEPALNICVDPDC
SIWYFYTLNDQTKKCESLSSRFYVFIIIILTLLILDIQSYYFYRKSVHVAKTSSR

Gene-Specific Links for PF10_0177b

General Sub-Cellular Localisation Links