ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0168-b (GRASP, GRASP1)

golgi re-assembly stacking protein 1, a gene from Plasmodium falciparum

Compiled localisation
cis-golgi during merozoite and ring and schizont and trophozoite
not trans golgi during merozoite and ring and schizont and trophozoite
golgi matrix and not endoplasmic reticulum during ring and schizont and trophozoite
not exported during schizont
golgi apparatus during extracellular merozoite and ring and schizont and trophozoite

Who localised this protein by microscopy?

Struck, N. S., Herrmann, S., Langer, C., Krueger, A., Foth, B. J., Engelberg, K., Cabrera, A. L., Haase, S., Treeck, M., Marti, M., Cowman, A. F., Spielmann, T., Gilberger, T. W.
Plasmodium falciparum possesses two GRASP proteins that are differentially targeted to the Golgi complex via a higher- and lower-eukaryote-like mechanism. (2008 Jul 1, J Cell Sci) PubMed / full text
   more detail about this publication

golgi apparatus during extracellular merozoite and ring and schizont and trophozoite
  • "Plasmodium falciparum possesses two GRASP proteins that are differentially targeted to the Golgi complex via a higher- and lower-eukaryote-like mechanism"
  • Microscopy type: Fixed Light
  • Microscopy method: HA tag
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Golgi complex during ring and trophozoite and schizont and free merozoite
  • Other genes localised in this publication: golgi re-assembly stacking protein 2

Struck, N. S., Herrmann, S., Schmuck-Barkmann, I., de Souza Dias, S., Haase, S., Cabrera, A. L., Treeck, M., Bruns, C., Langer, C., Cowman, A. F., Marti, M., Spielmann, T., Gilberger, T. W.
Spatial dissection of the cis- and trans-Golgi compartments in the malaria parasite Plasmodium falciparum. (2008 Mar, Mol Microbiol) PubMed / full text
   more detail about this publication

not exported during schizont
  • "This hypothesis was challenged by recent studies using green fluorescent protein (GFP)-tagged marker proteins, showing that neither the Golgi marker Golgi reassembly stacking protein (GRASP) (Struck et al., 2005) nor the COPII protein Sar1p (Adisa et al., 2007) is exported."
  • Microscopy type: Light
  • Microscopy method: C terminal GFP tag
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: not exported during schizont
  • Other genes localised in this publication: protein transport protein Sec13, putative, heat shock protein 70, Rab GTPase 6

Lee, M. C., Moura, P. A., Miller, E. A., Fidock, D. A.
Plasmodium falciparum Sec24 marks transitional ER that exports a model cargo via a diacidic motif. (2008 Jun, Mol Microbiol) PubMed / full text
   more detail about this publication

cis-golgi and not endoplasmic reticulum during ring and schizont and trophozoite
  • "Fig.2.Comparison of PfSec12 localization with markers for the ER and Golgi. Parasites were co-transfected with plasmids for expression of mRFPPfSec12 (from the native pfsec12 5' UTR) with either (A) GFPSDEL, a marker for the general ER, or (B) PfGRASPGFP, a cis-Golgi marker. mRFPPfSec12 was localized throughout the ER coincident with GFPSDEL, in close apposition to PfGRASP-labelled Golgi."
  • Microscopy type: Light
  • Microscopy method: C terminal GFP tag
  • Strain: Dd2
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Cis golgi and not ER during ring and troph and schizont
  • Other genes localised in this publication: ER membrane protein Sec12, Sec24 subunit a, heat shock protein 70

Adisa, A., Frankland, S., Rug, M., Jackson, K., Maier, A. G., Walsh, P., Lithgow, T., Klonis, N., Gilson, P. R., Cowman, A. F., Tilley, L.
Re-assessing the locations of components of the classical vesicle-mediated trafficking machinery in transfected Plasmodium falciparum. (2007 Aug, Int J Parasitol) PubMed / full text
   more detail about this publication

golgi matrix during ring and schizont and trophozoite
  • "We also compared PfBet3p location with that of a plasmodial homolog of the Golgi matrix protein, GRASP, which has recently been characterised using immunolabelling and GFP transfection approaches (Struck et al., 2005)."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: Found by annotation and blast from homologue
  • Localisation record: golgi matrix during ring and troph and schizont
  • Other genes localised in this publication: small GTP-binding protein sar1, Bet3 transport protein, putative, Rab GTPase 6

Struck, N. S., de Souza Dias, S., Langer, C., Marti, M., Pearce, J. A., Cowman, A. F., Gilberger, T. W.
Re-defining the Golgi complex in Plasmodium falciparum using the novel Golgi marker PfGRASP. (2005 Dec 1, J Cell Sci) PubMed / full text
   more detail about this publication

cis-golgi and not trans golgi during merozoite and ring and schizont and trophozoite
  • "PfGRASP-GFP does not colocalise with the trans-Golgi marker PfRab6. "
  • Microscopy type: Light
  • Microscopy method: GFP tag, polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: Taken directly from paper, as suggested in the paper it is a 2 exon gene and the first exon has 11 amino acids
  • Localisation record: Cis golgi and not trans golgi during ring and troph and schizont and merozoite
  • Other genes localised in this publication: Rab GTPase 6, heat shock protein 70, ER lumen protein retaining receptor

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11551

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF10_0168-b golgi re-assembly stacking protein 1
MGAGQTKEIMGGYRILRISENSPCSNVGLEIFFDYIIQIDDLKLLDSSKRTYDNFIEKIKLHENKELTLDIYNCRYDKIK
KVKVIPGKWEGNGLLGIHISYEFLNALNEGVRILEILENSPAYQSQLIEYEDFIIGYDKGIFRNQDEFMSYINMNNIIKE
NSHDKKVLFNTILYVYNYKHENIRKVQIQLNDSWGGKGLLGCNVATGYLHKIPPCQIKDKEEKENINLKESFSSSHIKNN
ESESNNYKKEHMDITKVNDLEIVLLNDSVGKNTNNINNTESNEKNSTNIIPLWKNEAEKSGREDKNYINSQDVELNHDNN
IKYMKNDSNSNSHSSNGSSKTLEVDMDNNAETINYDDKFSYELKSTLDDQPEEDMHEIKKENFQNEQVILEDIKREEPNN
SQEIKNEIDTYNFKNEDIKDEIHIIKPEPINTDNDKTSRLVESYSDYVKKMTIYSKEMNEIYESMNKNSEILNSIKMNAT
FNYVNDNNNNNNNNVLNVDKRVNTEEYKNVDSQEIPILINPYENTTILNSSKMDNITKGTYINNKNDDIYSNENVQHFHE
PSFNYVHDVRKNI

Gene-Specific Links for PF10_0168-b

General Sub-Cellular Localisation Links