ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0159 (GBP130)

glycophorin binding protein, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte cytoplasm during early trophozoite and late trophozoite and ring
intracellular during trophozoite
single small vesicle in erythrocyte during late trophozoite
surrounding parasite during segmenter

Who localised this protein by microscopy?

Marti, M., Good, R. T., Rug, M., Knuepfer, E., Cowman, A. F.
Targeting malaria virulence and remodeling proteins to the host erythrocyte. (2004 Dec 10, Science) PubMed / full text
   more detail about this publication

erythrocyte cytoplasm during early trophozoite and late trophozoite and ring
  • "Representative cells expressing the exported reporter (+Pexel) are shown in ring stage (left), early (center), and late trophozoites (right). Note that KAHRP-GFP is already exported into the host cell in early stages, whereas GBP130-YFP is retained in the parasitophorous vacuole and released after development into mature trophozoite stages, perhaps because of its unusually recessed or embedded signal sequence (see also fig. S3)."
  • Microscopy type:
  • Microscopy method:
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Erythrocyte Cytoplasm during ring and early troph and late troph
  • Other genes localised in this publication: knob-associated histidine-rich protein, erythrocyte membrane protein 1, PfEMP1

Perkins, M.
Stage-dependent processing and localization of a Plasmodium falciparum protein of 130,000 molecular weight. (1988 Feb, Exp Parasitol) PubMed / full text
   more detail about this publication

intracellular during trophozoite, single small vesicle in erythrocyte during late trophozoite, surrounding parasite during segmenter
  • "Immunofluorescent staining of the parasite at different intracellular stages indicates that the protein is localized on the parasite at the trophozoite stage. At late trophozoite stage, it appears to be transported to the erythrocyte cytoplasm, where it is present in small vesicles or inclusions. In mature schizonts the protein accumulates around the plasma membrane of the erythrocyte. At the segmenter stage, just prior to merozoite release, it appears also to surround the intracellular merozoite, as well as the erythrocyte plasma membrane."
  • Microscopy type:
  • Microscopy method: polyclonal antibody
  • Strain:
  • Gene model mapping comments: Blast from M12897, annotation matcehs
  • Localisation record: intracellular during troph, small vesicles in erythrocyte cytoplasm during late troph, surrounding intracellular merozoite during segmenter
  • Comment: no fulltext available online
  • Comment: strain information not found
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_73124

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF10_0159 glycophorin binding protein
MRLSKVSDIKSTGVSNYKNFNSKNSSKYSLMEVSKKNEKKNSLGAFHSKKILLIFGIIYVVLLNAYICGDKYEKAVDYGF
RESRILAEGEDTCARKEKTTLRKSKQKTSTRTVATQTKKDEENKSVVTEEQKVESDSEKQKRTKKVVKKQINIGDTENQK
EGKNVKKVIKKEKKKEESGKPEENKHANEASKKQEPKASKVSQKPSTSTRSNNEVKIRAASNQETLTSADPEGQIMREYA
ADPEYRKHLEIFYKILTNTDPNDEVERRNADNKEDLTSADPEGQIMREYASDPEYRKHLEIFYKILTNTDPNDDVERRNA
DNKEDLTSADPEGQIMREYAADPEYRKHLEVFHKILTNTDPNDEVERRNADNKEDLTSADPEGQIMREYAADPEYRKHLE
VFHKILTNTDPNDEVERRNADNKELTSSDPEGQIMREYAADPEYRKHLEVFHKILTNTDPNDEVERRNADNKEDLTSADP
EGQIMREYAADPEYRKHLEVFHKILTNTDPNDEVERRNADNKEDLTSADPEGQIMREYAADPEYRKHLEIFHKILTNTDP
NDEVERRNADNKEDLTSADPEGQIMREYAADPEYRKHLEIFYKILTNTDPNDEVERRNADNKEELTSSDPEGQIMREYAA
DPEYRKHLEIFHKILTNTDPNDEVERRNADNKEDLTSADPEGQIMREYAADPEYRKHLEIFYKILTNTDPNDEVERRNAD
NKEDLTSADPEGQIMREYASDPEYRKHLEIFYKILTNTDPNDDVERRNADNKEDLTSADPEGQIMREYAADPEYRKHLEV
FHKILTNTDPNDEVERQNADNNEA

Gene-Specific Links for PF10_0159

General Sub-Cellular Localisation Links