ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0156 ()

conserved Plasmodium protein, unknown function, a gene from Plasmodium falciparum

Compiled localisation
apical during extracellular merozoite and late schizont

Who localised this protein by microscopy?

Hu, G., Cabrera, A., Kono, M., Mok, S., Chaal, B. K., Haase, S., Engelberg, K., Cheemadan, S., Spielmann, T., Preiser, P. R., Gilberger, T. W., Bozdech, Z.
Transcriptional profiling of growth perturbations of the human malaria parasite Plasmodium falciparum. (2010 Jan, Nat Biotechnol) PubMed / full text
   more detail about this publication

apical during extracellular merozoite and late schizont

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48211

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_121440 conserved Plasmodium protein, unknown function
  • PY06645 asparagine-rich protein, putative
  • PVX_095020 hypothetical protein, conserved
  • PCHAS_121510 conserved Plasmodium protein, unknown function
  • PKH_081620 conserved Plasmodium protein, unknown function
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF10_0156 conserved Plasmodium protein, unknown function
MKNKSIRKERQSGETLEDNIEEINYCIKVIPKDKINSKGNGAIRLSNLDMNRSNNGNYYNQNNNVENINDFETECRNYIE
DILKIDEYVKLPNSINNEQDKIKWKKAHSLRNRMKEYDLITRTRLYQSNSVNNKAKLNRERYIILNKIPRYREAFPSIMN
NTSTDKIKEDIIRTYLKTHAAYFLSQNKKNSNLSLKNMGRNTYFSFRKKSDDRNNSLINYNKHMNDKSKSVEHNNCPNLK
KKDRSYNLWKRITVDDIKNTHFTPTEKQYLKDYNIFLNDAFNNFKINQNNNKRQLNVKNQKNIPNYDMINNKIYGHIKNN
ANNNLYINNQKREDAYIINPSQNNIITSPNEEQYPYFNNYSYSDKNKNLSTYNTEGKRNIYTNDVKSNTNYQHSNNSNYS
DESLNMFSNSSTSIYEKYNLKDKNFVLKRDRYALLGKIKNNKEIEVKLVLNKV

Gene-Specific Links for PF10_0156

General Sub-Cellular Localisation Links