ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0155 (enolase)

enolase, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during merozoite and schizont
cytoplasm during merozoite and schizont
cytosol and not erythrocyte cytoplasm and not erythrocyte plasma membrane and nucleus during gametocyte and ring and schizont and trophozoite

Who localised this protein by microscopy?

Bhowmick, I. P., Kumar, N., Sharma, S., Coppens, I., Jarori, G. K.
Plasmodium falciparum enolase: stage-specific expression and sub-cellular localization. (2009, Malar J) PubMed / full text
   more detail about this publication

cytosol and nucleus and not erythrocyte cytoplasm and not erythrocyte plasma membrane during gametocyte and ring and schizont and trophozoite, parasite plasma membrane during merozoite
  • "In addition to cytosolic localization of enolase, its presence in the nucleus was observed in the ring and trophozoite stages (Figure 2). The nucleus and food vacuole have significantly higher levels of enolase present in early (Figure 4) and mid stage trophozoites (Figure 5) as compared to the late stage trophozoite (Figure 5) and the schizont (Figure 6). Nuclear enolase at gametocyte stage is also low as compared to cytosol (Figure 7). Further, in all these images there was no observable association of Pfen with infected host cell cytosol or cell membrane, suggesting that Pfen is not secreted into the cytosol or translocated to the cell membrane of the infected rbcs. This observation is at variance from the earlier reports [41. "
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7 and NF54
  • Gene model mapping comments: blast from U00152.1, annotation matches
  • Localisation record: cytosol and nucleus and nucleus and not RBC cytosol and not RBC membrane during ring and trophozoite and schizont and gametocyte, surface during merozoite
  • Comment: relative staining of cytosol and nucleus varied widely between individual parasites
  • Other genes localised in this publication: 6-cysteine protein, fructose-bisphosphate aldolase, enolase

Pal-Bhowmick, I., Mehta, M., Coppens, I., Sharma, S., Jarori, G. K.
Protective properties and surface localization of Plasmodium falciparum enolase. (2007 Nov, Infect Immun) PubMed / full text
   more detail about this publication

cytoplasm and parasite plasma membrane during merozoite and schizont
  • "An indirect IFA showed that in addition to the cytoplasmic presence of enolase, the typical beehive pattern of a surface protein was also observed when P. falciparum schizonts were stained with anti-enolase antibodies, and there was significant colocalization of enolase with MSP-1 protein (Fig. 2D). These results support the view that enolase is localized on the surface of P. falciparum merozoites."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly against protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface and cytoplasm during merozoite and schizont
  • Other genes localised in this publication: merozoite surface protein 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10159

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF10_0155 enolase
MAHVITRINAREILDSRGNPTVEVDLETNLGIFRAAVPSGASTGIYEALELRDNDKSRYLGKGVQKAIKNINEIIAPKLI
GMNCTEQKKIDNLMVEELDGSKNEWGWSKSKLGANAILAISMAVCRAGAAANKVSLYKYLAQLAGKKSDQMVLPVPCLNV
INGGSHAGNKLSFQEFMIVPVGAPSFKEALRYGAEVYHTLKSEIKKKYGIDATNVGDEGGFAPNILNANEALDLLVTAIK
SAGYEGKVKIAMDVAASEFYNSENKTYDLDFKTPNNDKSLVKTGAQLVDLYIDLVKKYPIVSIEDPFDQDDWENYAKLTA
AIGKDVQIVGDDLLVTNPTRITKALEKNACNALLLKVNQIGSITEAIEACLLSQKNNWGVMVSHRSGETEDVFIADLVVA
LRTGQIKTGAPCRSERNAKYNQLLRIEESLGNNAVFAGEKFRLQLN

Gene-Specific Links for PF10_0155

General Sub-Cellular Localisation Links