ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0153 (Cpn60, Hsp60, hsp60)

heat shock protein 60, a gene from Plasmodium falciparum

Compiled localisation
mitochondrion during ring and schizont and segmenter and trophozoite
not apicoplast during ring and schizont and trophozoite
cytoplasm during gamete and gametocyte and intraerythrocytic and salivary gland sporozoite

Who localised this protein by microscopy?

Nagaraj, V. A., Arumugam, R., Prasad, D., Rangarajan, P. N., Padmanaban, G.
Protoporphyrinogen IX oxidase from Plasmodium falciparum is anaerobic and is localized to the mitochondrion. (2010 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

mitochondrion
  • ""
  • Microscopy type: Fixed Light
  • Microscopy method: Immunofluorescence data presented in Fig. 5 indicate that PfPPO colocalizes with PfHSP60, a mitochondrial marker, but not with PfPBGD, an apicoplast marker, establishing that PfPPO is a mitochondrial enzyme
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: mitochondrion
  • Comment: strain information not found
  • Comment: stage information not found in publication
  • Other genes localised in this publication: protoporphyrinogen oxidase, porphobilinogen deaminase

Spork, S., Hiss, J. A., Mandel, K., Sommer, M., Kooij, T. W., Chu, T., Schneider, G., Maier, U. G., Przyborski, J. M.
An unusual ERAD-like complex is targeted to the apicoplast of Plasmodium falciparum. (2009 Aug, Eukaryot Cell) PubMed / full text
   more detail about this publication

mitochondrion
  • "As an additional control, we co-transfected 3D7PfsD1-1 with a construct encoding either the BTS of the apicoplast resident protein ACP or the mitochondrial targeting sequence of mitochondrial PfHsp60, fused to the red fluorescent protein DsRed."
  • Microscopy type: Light
  • Microscopy method: DsRed tag
  • Strain: 3D7
  • Gene model mapping comments: Publication states that PFL1545c is mitochondrial Hsp60. However, this has been shown the be apicoplast previously, so is likely a mistake, and PF10_0153 was the actual gene used.
  • Localisation record: Mitochondria
  • Other genes localised in this publication: DER1-like protein, derlin-1, derlin-1, ubiquitin-activating enzyme, acyl carrier protein, DER1-like protein, putative, ubiquitin, AAA family ATPase, CDC48 subfamily

Nagaraj, V. A., Prasad, D., Rangarajan, P. N., Padmanaban, G.
Mitochondrial localization of functional ferrochelatase from Plasmodium falciparum. (2009 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

mitochondrion and not apicoplast
  • "PfFC clearly co-localizes with PfHSP60 (mitochondrial marker) and not with PfPBGD (apicoplast marker)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Mitochondria and not apicoplast
  • Other genes localised in this publication: ferrochelatase, porphobilinogen deaminase

Nagaraj, V. A., Arumugam, R., Chandra, N. R., Prasad, D., Rangarajan, P. N., Padmanaban, G.
Localisation of Plasmodium falciparum uroporphyrinogen III decarboxylase of the heme-biosynthetic pathway in the apicoplast and characterisation of its catalytic properties. (2009 Apr, Int J Parasitol) PubMed / full text
   more detail about this publication

mitochondrion and not apicoplast
  • "The results presented in Fig. 9 clearly indicate that PfUROD co-localised with PfPBGD but not with PfHSP60 (a mitochondrial marker). Therefore, it can be concluded that PfUROD is localised in the apicoplast and not the mitochondrion."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Mitochondria and not apicoplast
  • Comment: strain information not found
  • Comment: stage information not found in publication
  • Other genes localised in this publication: uroporphyrinogen III decarboxylase, porphobilinogen deaminase

Ponpuak, M., Klemba, M., Park, M., Gluzman, I. Y., Lamppa, G. K., Goldberg, D. E.
A role for falcilysin in transit peptide degradation in the Plasmodium falciparum apicoplast. (2007 Jan, Mol Microbiol) PubMed / full text
   more detail about this publication

mitochondrion during ring and schizont and segmenter and trophozoite
  • "FLNmitochondrion association. Clone MP3 was examined by IFA and epifluorescence microscopy using rabbit anti-Hsp60 (red) and goat anti-GFP (green) antibodies."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: MP3
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Mitochondria during ring and troph and schizont and segmenter
  • Other genes localised in this publication: falcilysin, acyl carrier protein

Sato, S., Wilson, R. J.
Organelle-specific cochaperonins in apicomplexan parasites. (2005 Jun, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

mitochondrion and not apicoplast during ring and schizont
  • "In double-transfectants, PfCpn10-DsRED co-localized with PfHsp60-GFP (Fig. 3A and B), whereas PfCpn10-DsRED and PfACP-GFP did not co-localize (Fig. 3C). This indicates that PfCpn10 specifically localizes to the mitochondrion."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from paper, Blast from U38963, annotation matches
  • Localisation record: Mitochondria and not apicoplast during ring and schizont
  • Other genes localised in this publication: 10 kd chaperonin, cochaperonin, acyl carrier protein

McMillan, P. J., Stimmler, L. M., Foth, B. J., McFadden, G. I., Muller, S.
The human malaria parasite Plasmodium falciparum possesses two distinct dihydrolipoamide dehydrogenases. (2005 Jan, Mol Microbiol) PubMed / full text
   more detail about this publication

mitochondrion and not apicoplast during ring and schizont and trophozoite
  • "Colocalization experiments with the apicoplast protein ACP (C) and with the two mitochondrial markers MitoTracker Red and HSP60 (D and E) indicate that mLipDH is localized exclusively in the mitochondrion."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody to homologue
  • Strain: D10
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Mitochondria and not apicoplast during ring and troph and schizont
  • Other genes localised in this publication: lipoamide dehydrogenase, lipoamide dehydrogenase, acyl carrier protein

Hodges, M., Yikilmaz, E., Patterson, G., Kasvosve, I., Rouault, T. A., Gordeuk, V. R., Loyevsky, M.
An iron regulatory-like protein expressed in Plasmodium falciparum displays aconitase activity. (2005 Sep, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

mitochondrion during trophozoite
  • "Trophozoite-infected red blood cells were probed with primary antibodies [(rabbit anti-PfIRPa 3950) and (mouse anti-Hsp60)] followed by fluorescent secondary antibodies [(goat anti-rabbit, alexa568) and (goat anti-mouse alexa488)] as described in Section 2. The mitochondrial compartment of the intraerythrocytic trophozoite was stained in green (Fig. 2D), whereas PfIRPa was stained in red (Fig. 2C)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: mitochondrion during trophozoite
  • Other genes localised in this publication: aconitase

Sato, S., Wilson, R. J.
The use of DsRED in single- and dual-color fluorescence labeling of mitochondrial and plastid organelles in Plasmodium falciparum. (2004 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

mitochondrion and not apicoplast during schizont and trophozoite
  • "In pSSPF2/PfHsp60-DsRED transfectants, the red fluorescence co-localized precisely with the green signal given by MTG, indicating that DsRED was targeted correctly to the mitochondrion."
  • Microscopy type: Light
  • Microscopy method: DsRed tag
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: mitochondria and not apicoplast during troph and schizont
  • Other genes localised in this publication: chaperonin, cpn60, acyl carrier protein

Varadharajan, S., Sagar, B. K., Rangarajan, P. N., Padmanaban, G.
Localization of ferrochelatase in Plasmodium falciparum. (2004 Dec 1, Biochem J) PubMed / full text
   more detail about this publication

mitochondrion
  • "It is clearly seen that the green fluorescence due to PfFC (FITC-conjugated secondary antibody) does not co-localize with the red fluorescence due to PfHsp60 (TRITC-conjugated secondary antibody). The latter is an established Plasmodium mitochondrial marker [20. "
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Mitochondria
  • Comment: strain information not found
  • Other genes localised in this publication: ferrochelatase

Tonkin, C. J., van Dooren, G. G., Spurck, T. P., Struck, N. S., Good, R. T., Handman, E., Cowman, A. F., McFadden, G. I.
Localization of organellar proteins in Plasmodium falciparum using a novel set of transfection vectors and a new immunofluorescence fixation method. (2004 Sep, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

mitochondrion

Sato, S., Rangachari, K., Wilson, R. J.
Targeting GFP to the malarial mitochondrion. (2003 Aug 31, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

mitochondrion and not apicoplast during schizont and trophozoite
  • "Localization of GFP to the mitochondrion was strict, regardless of the developmental stage of parasites transfected with pSSPF2/PfHsp60-GFP, suggesting that the parasites machinery for targeting nucleus-encoded mitochondrial proteins functions constitutively."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: mitochondria and not apicoplast during troph and schizont
  • Other genes localised in this publication: cysteine desulfurase, putative, acyl carrier protein

Das, A., Syin, C., Fujioka, H., Zheng, H., Goldman, N., Aikawa, M., Kumar, N.
Molecular characterization and ultrastructural localization of Plasmodium falciparum Hsp 60. (1997 Sep, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

mitochondrion during trophozoite, cytoplasm during gamete and gametocyte and intraerythrocytic and salivary gland sporozoite
  • "In addition, immunoelectron microscopic analysis distinctly localized PfHsp60 in the mitochondrion of P. falciparum."
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 7G8
  • Gene model mapping comments: Blast from U94594, annotation matches
  • Localisation record: mitochondrion during troph
  • Other genes localised in this publication: -
  • "Immunofluorescence analysis indicated the presence of PfHsp60 in the cytoplasm of all the various stages of the parasite. "
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 7G8
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytoplasm during asexual
  • Other genes localised in this publication: -
  • "Immunofluorescence analysis indicated the presence of PfHsp60 in the cytoplasm of all the various stages of the parasite. "
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytoplasm during gametocyte and gamete
  • Other genes localised in this publication: -
  • "Immunofluorescence analysis indicated the presence of PfHsp60 in the cytoplasm of all the various stages of the parasite. "
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: NF54
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytoplasm during salivary gland sporozoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10230

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF10_0153 heat shock protein 60
MISTLRGKIFNNGSNRNKCVSILSNIQKRNISKDIRFGSDARTAMLTGCNKLADAVSVTLGPKGRNVIIEQSFGSPKITK
DGVTVAKSIEFNNKLANLGAQMVKQVAANTNDKAGDGTTTATILARSIFQQGCKAVDSGMNPMDLLRGINKGVEKVLEYL
NSIKKDVTTTEEIFNVASISANGDKNIGQLIADTMKKVGKEGTITVTEGKTLQHELEIVEGIKFDRGYISPYFINNSKDQ
KVELDKPYILIHEKKISTVKSLLPVLEHVLQNQSSLLVIAEDVDSDALATLIVNKLRLGLKICAVKAPGFGEHRKALIHD
IAVMTGAKVITEETGLKLDDPQVVSYLGKAKSINVTKDSTLIMEGEGKKEEINERCESIRNAIKMNTSDYEKEKLQERLA
KITGGVALIKVGGISEVEVNEIKDRIQDALCATKAAVEEGIVPGGGSALLFASKELDSVQTDNYDQRVGVNIIKDACKAP
IKQIAENAGHEGSVVAGNILKEKNSNIGFNAQEGKYVDMIESGIIDPTKVVKTAISDAASIASLMTTTEVAIVDFKDSKN
EESSQHMNSVNSMGDMGGMY

Gene-Specific Links for PF10_0153

General Sub-Cellular Localisation Links