ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF10_0019 (ETRAMP10.1)

early transcribed membrane protein 10.1, a gene from Plasmodium falciparum

Compiled localisation
parasitophorous vacuole membrane during ring
not parasite plasma membrane

Who localised this protein by microscopy?

Spielmann, T., Gardiner, D. L., Beck, H. P., Trenholme, K. R., Kemp, D. J.
Organization of ETRAMPs and EXP-1 at the parasite-host cell interface of malaria parasites. (2006 Feb, Mol Microbiol) PubMed / full text
   more detail about this publication

parasitophorous vacuole membrane during ring
  • "When ETRAMP2myc was compared with another highly transcribed ring-specific ETRAMP (ETRAMP10.1), focal PVM staining of the two antigens with very limited overlap was observed (Fig.5B)."
  • Microscopy type: Light
  • Microscopy method: myc tag, polyclonal antibody directly to protein
  • Strain: D10
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PVM during ring
  • Other genes localised in this publication: early transcribed membrane protein 2, early transcribed membrane protein 4

Spielmann, T., Fergusen, D. J., Beck, H. P.
etramps, a new Plasmodium falciparum gene family coding for developmentally regulated and highly charged membrane proteins located at the parasite-host cell interface. (2003 Apr, Mol Biol Cell) PubMed / full text
   more detail about this publication

parasitophorous vacuole membrane and not parasite plasma membrane

Orthology

OrthoMCL

Part of OrthoMCL group OG4_118692

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF10_0019 early transcribed membrane protein 10.1
MKISKILFFFVAIIAVKLFIPGYVLGGSSGSGGVKKLTDAQKKKKNIIIFSSVASVLAALIGAGVGFGIYYKNHKSDNKD
EGNDKKGSNDSKNKSQEGSTPLLTAKA

Gene-Specific Links for PF10_0019

General Sub-Cellular Localisation Links