ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF08_0131 (1-Cys-Prx)

1-cys peroxiredoxin, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm during trophozoite
during late schizont and ring

Who localised this protein by microscopy?

Yano, K., Komaki-Yasuda, K., Kobayashi, T., Takemae, H., Kita, K., Kano, S., Kawazu, S.
Expression of mRNAs and proteins for peroxiredoxins in Plasmodium falciparum erythrocytic stage. (2005 Mar, Parasitol Int) PubMed / full text
   more detail about this publication

cytoplasm during trophozoite, during late schizont and ring
  • "In contrast, significant staining of Pf1-Cys-Prx was detected in the trophozoites in the cytoplasm of the parasite"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: FCR-3
  • Gene model mapping comments: blast from primers TCG TGA GAT TCT TTG GAG TT and ATG GCT TAC CAT TTA GGA GCT AC
  • Localisation record: cytoplasm during trophozoite, weak during ring and late schizont
  • Other genes localised in this publication: thioredoxin peroxidase 1, thioredoxin, putative, thioredoxin peroxidase 2

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10063

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF08_0131 1-cys peroxiredoxin
MAYHLGATFPNFTATASNVDGVFDFYKYVGDNWAILFSHPHDFTPVCTTELAEFGKMHEEFLKLNCKLIGFSCNSKESHD
QWIEDIKFYGNLDKWDIPMVCDESRELANQLKIMDEKEKDIKGLPLTCRCVFFISPDKKVKATVLYPATTGRNSQEILRV
LKSLQLTNTHPVATPVNWKEGDKCCILPSVDNADLPKLFKNEVKKLDVPSQKAYLRFVQM

Gene-Specific Links for PF08_0131

General Sub-Cellular Localisation Links