ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF08_0108 (PM X)

plasmepsin X, a gene from Plasmodium falciparum

Compiled localisation
not food vacuole during trophozoite
apical during extracellular merozoite and late schizont

Who localised this protein by microscopy?

Hu, G., Cabrera, A., Kono, M., Mok, S., Chaal, B. K., Haase, S., Engelberg, K., Cheemadan, S., Spielmann, T., Preiser, P. R., Gilberger, T. W., Bozdech, Z.
Transcriptional profiling of growth perturbations of the human malaria parasite Plasmodium falciparum. (2010 Jan, Nat Biotechnol) PubMed / full text
   more detail about this publication

apical during extracellular merozoite and late schizont

Banerjee, R., Liu, J., Beatty, W., Pelosof, L., Klemba, M., Goldberg, D. E.
Four plasmepsins are active in the Plasmodium falciparum food vacuole, including a protease with an active-site histidine. (2002 Jan 22, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

not food vacuole during trophozoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_14295

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF08_0108 plasmepsin X
MKRISPLNTLFYLSLFFSYTFKGLKCTRIYKIGTKALPCSECHDVFDCTGCLFEEKESSHVIPLKLNKKNPNDHKKLQKH
HESLKLGDVKYYVNRGEGISGSLGTSSGNTLDDMDLINEEINKKRTNAQLDEKNFLDFTTYNKNKAQDISDHLSDIQKHV
YEQDAQKGNKNFTNNENNSDNENNSDNENNSDNENNLDNENNLDNENNSDNSSIEKNFIALENKNATVEQTKENIFLVPL
KHLRDSQFVGELLVGTPPQTVYPIFDTGSTNVWVVTTACEEESCKKVRRYDPNKSKTFRRSFIEKNLHIVFGSGSISGSV
GTDTFMLGKHLVRNQTFGLVESESNNNKNGGDNIFDYISFEGIVGLGFPGMLSAGNIPFFDNLLKQNPNVDPQFSFYISP
YDGKSTLIIGGISKSFYEGDIYMLPVLKESYWEVKLDELYIGKERICCDEESYVIFDTGTSYNTMPSSQMKTFLNLIHST
ACTEQNYKDILKSYPIIKYVFGELIIELHPEEYMILNDDVCMPAYMQIDVPSERNHAYLLGSLSFMRNFFTVFVRGTESR
PSMVGVARAKSKN

Gene-Specific Links for PF08_0108

General Sub-Cellular Localisation Links