ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF08_0071 (SOD1)

Fe-superoxide dismutase, a gene from Plasmodium falciparum

Compiled localisation
cytosol during schizont and trophozoite

Who localised this protein by microscopy?

Sienkiewicz, N., Daher, W., Dive, D., Wrenger, C., Viscogliosi, E., Wintjens, R., Jouin, H., Capron, M., Muller, S., Khalife, J.
Identification of a mitochondrial superoxide dismutase with an unusual targeting sequence in Plasmodium falciparum. (2004 Sep, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytosol during schizont and trophozoite
  • "Immunofluorescence studies show that PfSOD1 is cytosolic, whereas the N-terminal extension of PfSOD2 targets a green fluorescent protein fusion into the parasite's mitochondrion."
  • Microscopy type: Fixed Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: blast from PfSOD2
  • Localisation record: cytosol during trophozoite and schizont
  • Other genes localised in this publication: superoxide dismutase

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10139

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF08_0071 Fe-superoxide dismutase
MVITLPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNTLIKDTPFAEKSLLDIVKESSGAIFNNAAQIWNHTFYWDS
MGPDCGGEPHGEIKEKIQEDFGSFNNFKEQFSNILCGHFGSGWGWLALNNNNKLVILQTHDAGNPIKDNTGIPILTCDIW
EHAYYIDYRNDRASYVKAWWNLVNWNFANENLKKAMQK

Gene-Specific Links for PF08_0071

General Sub-Cellular Localisation Links