ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF08_0066 (aLipDH)

lipoamide dehydrogenase, a gene from Plasmodium falciparum

Compiled localisation
apicoplast and not mitochondrion during intraerythrocytic and ring and schizont and trophozoite

Who localised this protein by microscopy?

Gunther, S., Wallace, L., Patzewitz, E. M., McMillan, P. J., Storm, J., Wrenger, C., Bissett, R., Smith, T. K., Muller, S.
Apicoplast lipoic acid protein ligase B is not essential for Plasmodium falciparum. (2007 Dec, PLoS Pathog) PubMed / full text
   more detail about this publication

apicoplast and not mitochondrion during intraerythrocytic
  • "Immunofluorescent analyses were performed on P. falciparum 3D7 using anti-LplA2 and anti-aLipDH (aE3) antibodies (specifically staining the apicoplast of the parasites) as outlined in the Materials and Methods section."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast and not mitochondria during intraerythrocytic stages
  • Other genes localised in this publication: lipoate protein ligase a type 2

McMillan, P. J., Stimmler, L. M., Foth, B. J., McFadden, G. I., Muller, S.
The human malaria parasite Plasmodium falciparum possesses two distinct dihydrolipoamide dehydrogenases. (2005 Jan, Mol Microbiol) PubMed / full text
   more detail about this publication

apicoplast and not mitochondrion during ring and schizont and trophozoite
  • "Colocalization with antibodies directed against the apicoplast-resident acyl-carrier protein (ACP; A) and with MitoTracker Red (B) demonstrates that the putative apicoplast targeting presequence of aLipDH targets the marker protein GFP exclusively to the apicoplast. "
  • Microscopy type: Light
  • Microscopy method: GFP tag after first 134 amino acids
  • Strain: D10
  • Gene model mapping comments: Blast from primer GCGCAAGCTTATGGTCATAAGGCAAAATATTAAAC and GCGCGGATCCTAGTGAGTTCTTATTTTTGATATAGATTTAAAAGC, annotation matches
  • Localisation record: Apicoplast and not mitochondria during ring and troph and schizont
  • Other genes localised in this publication: lipoamide dehydrogenase, acyl carrier protein, heat shock protein 60

Orthology

OrthoMCL

Part of OrthoMCL group OG4_18600

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF08_0066 lipoamide dehydrogenase
MVIRQNIKHIVKLNVVTLIWLSYLFLLKPHGTLKNMMVCNAVLLPFNEKNKGINNFVYINPKNIILNKIKKDVIKLEKDN
IILCQHNRKRDNYIKQQKRKEKNANNFTFMLKGSTQNIMNINEKEYDLAIIGCGVGGHAAAINAMERNLKVIIFAGDENC
IGGTCVNVGCIPSKALLYATNKYRELKNLDKLYYYGIHSNIFQNNKNTEIENNQLVSNSFQINITKLKEYTQSVIDKLRN
GISHGFKTLKFNKNSEHVQVIYEHGQLLDKNTIKSKKSGNTYKVKNIIIATGSVPNIPNNVEIDDKSVFTSDMAVKLVGL
KNYMSIIGMGIIGLEFADIYTALGSEITFLEYSSELLPIIDNDVAKYFERVFLKNKPVNYHLNTEVKYIKASKNNNPVII
GYSHRTGNDDNEKKNMTDVKELYVDSCLVATGRNPNTQNLGLEKLKIQMNRGYVSVNDNLQVKMENNEIYDNIFCIGDAN
GKQMLAHTASYQALKVIDFIEKKEKKNVNINVENNLSKPILYKNIPSVCYTNPELAFIGLTEKEAKVLYPDNVGVEISYY
KSNSKILCENNISLNNNKKNNSYNKGQYNINDNTNGMVKIIYKEDTKEILGMFIVGNYASVLIHEAVLAINLKLSAFDLA
YMVHSHPTVSEVLDTAFKSISKIRTH

Gene-Specific Links for PF08_0066

General Sub-Cellular Localisation Links