ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF08_0063 (ClpB1)

ClpB protein, putative, a gene from Plasmodium falciparum

Compiled localisation
apicoplast

Who localised this protein by microscopy?

El Bakkouri, M., Pow, A., Mulichak, A., Cheung, K. L., Artz, J. D., Amani, M., Fell, S., de Koning-Ward, T. F., Goodman, C. D., McFadden, G. I., Ortega, J., Hui, R., Houry, W. A.
The Clp chaperones and proteases of the human malaria parasite Plasmodium falciparum. (2010 Dec 3, J Mol Biol) PubMed / full text
   more detail about this publication

apicoplast

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10114

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF08_0063 ClpB protein, putative
MVNSFFFCFVIIGLIYVWDITYSKKAKIFFNKNDIFSIKNTHWDIYDKKKYFFIGNNHLKNEESFLPEVRKDYKSQIKEY
KNSTNGIIYHNNKNRLSYTINDQVNYDNNMTSGINKKRKVKDSSIHMNNSYEKNRNKNKFALFMSDEEYTINSDDYTEKA
WEAISSLNKIGEKYDSAYVEAEMLLLALLNDSPDGLAERILKESGIDTQLLVQEIDDYLKKQPKMPSGFGEQKILGRTLQ
TVLSTSKRLKKEFNDEYISIEHLLLSIISEDSKFTRPWLLKYNVNYEKVKKAVEKIRGKKKVTSKTPEMTYQALEKYSRD
LTALARAGKLDPVIGRDNEIRRAIQILSRRTKNNPILLGDPGVGKTAIVEGLAIKIVQGDVPDSLKGRKLVSLDMSSLIA
GAKYRGDFEERLKSILKEVQDAEGQVVMFIDEIHTVVGAGAVAEGALDAGNILKPMLARGELRCIGATTVSEYRQFIEKD
KALERRFQQILVEQPSVDETISILRGLKERYEVHHGVRILDSALVQAAVLSDRYISYRFLPDKAIDLIDEAASNLKIQLS
SKPIQLENIEKQLIQLEMEKISILGDKQKNLFNYSSVANTHNNNNNSSISSNNSSSYGNAEETEATVDYTKSPNFLKKRI
NEKEIDRLKMIDRIMSELRKEQRKILDSWSTEKSYVDNIRAIKERIDVVKIEIEKAERYFDLNRAAELRFETLPDLEKQL
KKAEENYLNDIPEKSRILKDEVTSEDIVNIVSMSTGIRLNKLLKSEKEKILNLENELHKQIIGQDDAVKVVTKAVQRSRV
GMNNPKRPIASLMFLGPTGVGKTELSKVLADVLFDTPEAVIHFDMSEYMEKHSISKLIGAAPGYVGYEQGGLLTDAVRKK
PYSIILFDEIEKAHPDVYNLLLRVIDEGKLSDTKGNVANFRNTIIIFTSNLGSQSILDLANDPNKKEKIKEQVMKSVRET
FRPEFYNRIDDHVIFDSLSKKELKEIANIEIRKVANRLFDKNFKITIDDAVFSYIVDKAYDPSFGARPLKRVIQSEIETE
IAVRILDETFVENDTINISLKDQKLHFSKS

Gene-Specific Links for PF08_0063

General Sub-Cellular Localisation Links