ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF08_0036 (Sec23)

Pfsec23, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm and maurer's cleft during trophozoite

Who localised this protein by microscopy?

Wickert, H., Rohrbach, P., Scherer, S. J., Krohne, G., Lanzer, M.
A putative Sec23 homologue of Plasmodium falciparum is located in Maurer's clefts. (2003 Jul, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytoplasm and maurer's cleft during trophozoite
  • "This finding is consistent with PfSec23 being associated with Maurer's clefts. .. PfSec23 is localized in the parasite cytoplasm, as one would expect for a COPII protein present on vesicles that mediate anterograde protein transport from the ER to the Golgi [8, 11 and 24]."
  • Microscopy type: Fixed Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: Blast from CAD62683, annotation matches
  • Localisation record: maurer's clefts and parasite cytoplasm during trophozoite
  • Other genes localised in this publication: skeleton-binding protein 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10705

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF08_0036 Pfsec23
MDIHAQENQTGIRFSWNLWPPTKAEAAKIEVPLGCLYTVLKRTDDSSVKLVEYEPLKCKTSNCILNPYCNIDFRNKTWTC
PFSNIKNPFPLHYAEHISEKNLPADVMYSNIEYIQPSNVGDIPPPTFLFVIDTCLLEEELEQLKDSIQQCISLMPGDAYI
GIITFGNMCYVHEIGFNDCLKSYVFKGNKEISAQDLQKQLNLGSRNDPRSSTTSASARRFLQPVSECEYNINMLLEDIQK
DNWPTPPDQRAKRCTGVALSVAIGLLECCCNQLSGRVMMFIGGADTTSPGKIVDTPLSESLRHHLDLQKENSNARHVKKA
LKYYVSLANRAVASGHAIDIFACSLDQIGLYEMKVCCEKTNGFMVMADSFSMNVFKDSFKKIFETDSTEYIKHGYNAKLT
VICSKEFRVCGAIGACSSNKKTANYVSDTCVGEGGTCEWTICALDRQSTIAFYFEIVNQNLASLPPDRQAYLQFQTLYQH
PSGRRRLRVTTISYRFAEPNIAEISQGFDQETAAVIMARFAVLKAETDEPIDVLRWLDRKLIRLVSTFADYQKDDINSFH
LSSEFSIYPQFMYHLRRSHFLQTFNASPDETAYYRSILLRENVMNSLIMIQPALLQYSFDSPTPIPVLLDAQSLKSNVIL
LLDSYFHIVIWYGEMIYQWREQGFHEKPEYEHFRQLLNAPHEDAKSILEDRFPIPKFVLCNSGGSQSRFLLAKVNPSTTH
NSLSGSTFGTSSNESYIINTDDVSLKIFMDHLVKLAVQT

Gene-Specific Links for PF08_0036

General Sub-Cellular Localisation Links