ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF08_0034 (GCN5) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

histone acetyltransferase GCN5, a gene from Plasmodium falciparum

Compiled localisation
nucleus

Who localised this protein by microscopy?

Komaki-Yasuda, K., Okuwaki, M., Kano, S., Nagata, K., Kawazu, S.
5' sequence- and chromatin modification-dependent gene expression in Plasmodium falciparum erythrocytic stage. (2008 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

nucleus
  • "Recruitment of PfGCN5 histone acetyltransferase to the pf1-cys-prx enhancer in trophozoite/schizont stage was observed. "
  • Microscopy type: ChIP
  • Microscopy method: antibody directly to protein
  • Strain: FCR3
  • Gene model mapping comments: Taken directly from 15075257, Blast from AY498855.1, gene model inconsistent
  • Localisation record: Nucleus
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11340

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF08_0034 histone acetyltransferase GCN5
MDYLIRNNEYCNVLYDGNELLRKRKINFDNEICPYKMNYWNNYNNNINIDNDNMNNEIVNEEFENTYNNINNNMYYLLGK
EDMDEPRLCNKKRNVYNENFKNNLEYDENVNNYDNDNSSNISYKFINNECDKMKKSGEGTQENNDNENNNNDESNNNNNN
NNNESNNNNNNNESNNNNNNNNNNESNNNNNNNESNNNNHGNNNNSSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
DKNEDDENTTGKGKKTEVKKRAGRKRNDSTMYANSNTMLKNNFLQNNKMIYNNMDHINDTNEQDKFLYEQRKMMMNNKME
NMGPNMNMTNKNYFQTVNNMKMNVENNKNLIGINTNNMNNYQNNINSINTNMNIPKNKNLHSNKQMMFMNNNMNIHGKTN
KLNDMARMNSINFNEENKMSVMNDDTRMDNKMRDIMKSGGMEVHLKNEESLYMNNMYNMNSNNPNNIPRISTMNIAKPMN
NFNNMNMPINNMNAYNNHMINSYNNMMMTNNMNNINNINNINHINNNNNSNNNNNSNNSNNNINFGQHIQGVQFMNPNMN
NDMNSNMNNINNNQMFLNNNQNNAHVHMVNNMNLNPSGNNSFFNNSNKHLNMMTMSSKNKKNAILKNTENNEFENIKRVH
SNSSNYNNNNNNNSDSNNKKSIKMNSNENNNTTTTIIKNIRVENIKFNESVNLKNIDGLDLSTNFVNGKYISKLNNDEKI
YNVVHSIVKDSLKDCLVDFYNNANYIFKDKLDFVCNSNTPTCNNINDLEDNKKDDGHVDKQNYSLEKKDNEEHTNNNSDP
IMDGVELDVKKISEKKEDQIEKDKPKNDNTKNDNTKEDKNQNDDNKTNTSIPKTPKNEVKNVITSSLLSSFNIFSAFSNS
NTPNSKKNKYDEEEEKEEKEEEEENNKCNDKDDEDKNKSPQNEDNKNITNDNNDNNNNNVDKENNLKESIDNLGNVDTDN
NIKRDVLNYNNIEENEQSREYILIEITKSICSIINLQQLMPVNTRLANPNLIYDPNYETIYSKWKTFLRKEQSSGNLISN
CFSRDFLHTILLCNYVTIIEDLRKTAVKKKLKYFFLHLCLESGISINVALMLFINATKQSDKLQSLLPSETGLGYLHRDA
GGAKEENMGIITFECITNDREPDHLIKLITLKNIFSRQLPKMPREYIVRLVFDRNHYTFCLLKKNTVIGGVCFRPYFEQK
FAEIAFLAVTSTEQVKGYGTRLMNHLKEHVKKFGIEYFLTYADNFAIGYFRKQGFSQKISMPKERWFGYIKDYDGGTLME
CYIFPNINYLRLSEMLYEQKKAVKKAIHFIKPQVIYKGINYFADNKGAALHPSTIPGLLEVGWKKETREITKKVQHKEVQ
LKDQILGVLDYLEKQQSAWPFLKPVSLSEAPDYYDIIKEPTDILTMRRKARHGDYKTKEDFGIELKRMFDNCRLYNAPTT
IYFKYANELQTLIWPKYEAITDTAK

Gene-Specific Links for PF08_0034

General Sub-Cellular Localisation Links