ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF08_0031 (OMT)

oxoglutarate/malate translocator protein, putative, a gene from Plasmodium falciparum

Compiled localisation
mitochondrion

Who localised this protein by microscopy?

van Dooren, G. G., Stimmler, L. M., McFadden, G. I.
Metabolic maps and functions of the Plasmodium mitochondrion. (2006 Jul, FEMS Microbiol Rev) PubMed / full text
   more detail about this publication

mitochondrion

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11142

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_070670 oxoglutarate/malate translocator, putative
  • PY02084 putative oxoglutarate/malate translocator protein
  • PVX_089165 mitochondrial 2-oxoglutarate/malate carrier protein, putative
  • PCHAS_071600 oxoglutarate/malate translocator, putative
  • PKH_050710 oxoglutarate/malate translocator protein, putative
  • NCLIV_033680 Solute carrier family 25 (Mitochondrial carrier, dicarboxylate transporter), member 10, related
  • cgd1_600 oxoglutarate/malate translocator protein
  • Chro.10071 oxoglutarate/malate translocator protein
  • CMU_035290 carrier protein, putative
  • TP02_0450 oxoglutarate / malate translocator, putative
  • TA13260 oxoglutarate/malate translocator protein, putative
  • BBOV_III005160 mitochondrial carrier protein family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF08_0031 oxoglutarate/malate translocator protein, putative
MDRDIAKYDLESSSSVDVNKKGNNNKSVFEKIKPFAVGGASGMFATFCIQPLDMVKVRIQLNAEGKNVLRNPFIVAKDII
KNEGFLSLYKGLDAGLTRQVIYTTGRLGLFRTFSDMVKKEGEPLPFYKKCFCALAAGGLGAFIGNPADLSLIRLQADNTL
PKELKRNYTGVFNALYRISKEEGLFALWKGSVPTIARAMSLNLGMLSTYDQSKEFLQKYLGVGMKTNLVASVISGFFAVT
LSLPFDFVKTCMQKMKADPVTKKMPYKNMLDCSIQLYKKGGISIFYSSYATYYVRIAPHAMITLITVDYLNNLLKKIS

Gene-Specific Links for PF08_0031

General Sub-Cellular Localisation Links