ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF07_0059 (PNPase)

4-nitrophenylphosphatase, a gene from Plasmodium falciparum

Compiled localisation
cytosol during early trophozoite and late trophozoite and ring

Who localised this protein by microscopy?

Knockel, J., Bergmann, B., Muller, I. B., Rathaur, S., Walter, R. D., Wrenger, C.
Filling the gap of intracellular dephosphorylation in the Plasmodium falciparum vitamin B1 biosynthesis. (2008 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytosol during early trophozoite and late trophozoite and ring
  • "The cytosolic localisation of this phosphatase was verified by transfection of a GFP chimera construct."
  • Microscopy type: Light
  • Microscopy method: GFP
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Cytosol during ring and young troph and old troph
  • Comment: strain information not found
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10508

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF07_0059 4-nitrophenylphosphatase
MALIYSSDKKDDDIINVEKKYESFLKEWNLNKMINSKDLCLEFDVFFFDCDGVLWHGNELIEGSIEVINYLLREGKKVYF
ITNNSTKSRASFLEKFHKLGFTNVKREHIICTAYAVTKYLYDKEEYRLRKKKIYVIGEKGICDELDASNLDWLGGSNDND
KKIILKDDLEIIVDKNIGAVVVGIDFNINYYKIQYAQLCINELNAEFIATNKDATGNFTSKQKWAGTGAIVSSIEAVSLK
KPIVVGKPNVYMIENVLKDLNIHHSKVVMIGDRLETDIHFAKNCNIKSILVSTGVTNANIYLNHNSLNIHPDYFMKSISE
LL

Gene-Specific Links for PF07_0059

General Sub-Cellular Localisation Links