ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF07_0006 (STARP)

sporozoite threonine and asparagine-rich protein, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during sporozoite
during hepatocyte

Who localised this protein by microscopy?

Fidock, D. A., Bottius, E., Brahimi, K., Moelans, I. I., Aikawa, M., Konings, R. N., Certa, U., Olafsson, P., Kaidoh, T., Asavanich, A., et, a. l. ..
Cloning and characterization of a novel Plasmodium falciparum sporozoite surface antigen, STARP. (1994 Apr, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane during sporozoite, during hepatocyte
  • "In sporozoites, transcription of the STARP gene has been conclusively demonstrated by reverse PCR and Northern blot hybridisation and the 78-kDa protein has been localized by immunofluorescence and immunoelectron microscopy to the sporozoite surface."
  • Microscopy type: Light, EM
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: Blast from Z26314, annotation matches
  • Localisation record: surface during sporozoite, during liver stages
  • Comment: fulltext not available online
  • Comment: strain information not found
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_15372

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PFD0080c Plasmodium exported protein (PHISTb), unknown function
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF07_0006 sporozoite threonine and asparagine-rich protein
MIHIFYRTAIFTLSIWTTLLYSNKNLKCNFYYNNNNLSTYVIKHNRFLSEYQSNFLGGGYSAALKLVNSKKSGTNVNTKY
NSENTNTNNNIPESSSTYTNTRLAANNSTTTSTTKVTDNNKTNIKLTGNNSTTINTNSTENTSATKKVTENVITNQILTG
NNNTTTNTSTTEHNNNINTNTNSTENTSATKKVTENVITNQILTGNNNTTTNTSTTEHNNNINTNTNSTDNSNTNTNLTD
NTSTTKKLTDNINTTQNLTTSTNTTTVSTDNNNINTKPIDNNNTDIKSTDNYNTGTKETDNKNTDIKATDNNNITTTTDN
TNTNVISTDNSKTNVISTDNSKTNTISTDNDNADTILTDNDNNTDIILTDNNNTDTISTDNDNADTKATDNNNNTNTKAT
DNNNTKIISPDNNNTKTTSTDNNNNTNTKATDNNNTKTISNDNNNTKTISTDNNNTKTISNDNNNTNTISTDNNNNNTNQ
YVFANNYNETTSDDELNKDSCDYSEEKENIKSMINAYLDKLDLETVRKIHSDISTCIEKKNNPRNQITHLNNLKNMYNII
KFIVVIYIAFNWSEVIYKYVGKLILAFALYMLIN

Gene-Specific Links for PF07_0006

General Sub-Cellular Localisation Links