ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL8P1.72 (HMGB2)

high mobility group protein, a gene from Plasmodium falciparum

Compiled localisation
nucleus during schizont and trophozoite
cytoplasm during gametocyte stage iv and gametocyte stage v

Who localised this protein by microscopy?

Briquet, S., Boschet, C., Gissot, M., Tissandie, E., Sevilla, E., Franetich, J. F., Thiery, I., Hamid, Z., Bourgouin, C., Vaquero, C.
High-mobility-group box nuclear factors of Plasmodium falciparum. (2006 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

nucleus during schizont and trophozoite, cytoplasm during gametocyte stage iv and gametocyte stage v
  • "Finally, immunofluorescence studies revealed differential subcellular localizations: both factors were observed in the nucleus of asexual- and sexual-stage cells, and PfHMGB2 was also detected in the cytoplasm of gametocytes."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from paper, blast from primer
  • Localisation record: Nucleus during troph and schizont, cytoplasm during gametocyte stage IV and gametocyte stage V
  • Comment: The level of PfHMGB1 expression was clearly lower in gametocytes than in mixed asexual stages, in contrast to PfHMGB2, whose expression was higher in gametocytes.
  • Other genes localised in this publication: high mobility group protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10272

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>MAL8P1.72 high mobility group protein
MASKSQKKVLKKQNKKKKKDPLAPKRALSAYMFYVKDKRLEIIKEKPELAKDVAQVGKLIGEAWGQLSPAQKAPYEKKAQ
LDKVRYSKEIEEYRKKNQE

Gene-Specific Links for MAL8P1.72

General Sub-Cellular Localisation Links