ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL8P1.69 ()

14-3-3 protein, putative, a gene from Plasmodium falciparum

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10210

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>MAL8P1.69 14-3-3 protein, putative
MATSEELKQLRCDCTYRSKLAEQAERYDEMADAMRTLVEQCVNNDKDELTVEERNLLSVAYKNAVGARRASWRIISSVEQ
KEMSKANVHNKNVAATYRKKVEEELNNICQDILNLLTKKLIPNTSESESKVFYYKMKGDYYRYISEFSCDEGKKEASNCA
QEAYQKATDIAENELPSTHPIRLGLALNYSVFFYEILNQPHQACEMAKRAFDDAITEFDNVSEDSYKDSTLIMQLLRDNL
TLWTSDLQGDQTEEKSKDEGLE

Gene-Specific Links for MAL8P1.69

General Sub-Cellular Localisation Links