ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL8P1.48 ()

splicing factor, putative, a gene from Plasmodium falciparum

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11971

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • MAL8P1.48 splicing factor, putative
  • PBANKA_070840 small nuclear ribonucleoprotein, putative
  • PY07229 putative small nuclear ribonucleoprotein polypeptide G
  • PVX_089250 small nuclear ribonucleoprotein G, putative
  • PCHAS_071760 small nuclear ribonucleoprotein, putative
  • PKH_050870 small nuclear ribonucleoprotein, putative
  • TGME49_114790 small nuclear ribonucleoprotein E/G, putative
  • NCLIV_057680 hypothetical protein
  • cgd7_3970 small nuclear ribonucleoprotein, putative
  • CMU_014080 small nuclear ribonucleoprotein G, putative
  • TP02_0700 small nuclear ribonucleoprotein G, putative
  • TA14640 small nuclear ribonucleoprotein, putative
  • BBOV_II007600 small nuclear ribonucleoprotein G, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>MAL8P1.48 splicing factor, putative
MTLTVGKAGPASDFRKFMEKRLQIYLNGNRQVVGILRGYDTFMNLVLDNTMEIKKDEQIDIGVVVIRGNSISYWECLDKV
NIK

Gene-Specific Links for MAL8P1.48

General Sub-Cellular Localisation Links