ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL8P1.17 (Pf52, PDI, DSI) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

protein disulfide isomerase, a gene from Plasmodium falciparum

Compiled localisation
endoplasmic reticulum and not cis-golgi during early trophozoite and late schizont and late trophozoite
not golgi apparatus

Who localised this protein by microscopy?

Gratraud, P., Huws, E., Falkard, B., Adjalley, S., Fidock, D. A., Berry, L., Jacobs, W. R. Jr, Baird, M. S., Vial, H., Kremer, L.
Oleic acid biosynthesis in Plasmodium falciparum: characterization of the stearoyl-CoA desaturase and investigation as a potential therapeutic target. (2009, PLoS One) PubMed / full text
   more detail about this publication

endoplasmic reticulum and not cis-golgi during early trophozoite and late schizont and late trophozoite
  • "As shown in Fig. 5B, PfSCD-GFP colocalized mostly with PfBiP and PfDSI (disulfide isomerase), two soluble ER markers [41], [43], therefore confirming the ER localization of PfSCD-GFP."
  • Microscopy type: Fixed light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: endoplasmic reticulum and not cis-golgi during early trophozoite and late trophozoite and segmented schizont
  • Other genes localised in this publication: stearoyl-CoA delta 9 desaturase, putative, heat shock protein 70, ER lumen protein retaining receptor, acyl carrier protein

Mouray, E., Moutiez, M., Girault, S., Sergheraert, C., Florent, I., Grellier, P.
Biochemical properties and cellular localization of Plasmodium falciparum protein disulfide isomerase. (2007 Mar, Biochimie) PubMed / full text
   more detail about this publication

endoplasmic reticulum and not golgi apparatus
  • "Antibodies were raised against recombinant (His)6-tagged forms of PfPDI devoid of its signal peptide sequence, demonstrating a major co-localization of PfPDI with endoplasmic reticulum-resident proteins, PfBIP and PfERC, but not with the Golgi marker PfERD2"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: FcB1
  • Gene model mapping comments: Taken directly from paper, Blast from AJ250363, gene model inconsistent
  • Localisation record: ER and not Golgi
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10306

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>MAL8P1.17 protein disulfide isomerase
MNRKYFSSLFLFLISFVFESFVRSHGDLFNHFVTDIHDGELDKFITKNDIVLVMFYAPWCGHCKRLIPEYNEAANMLNEK
KSEIKLVSIDATSENALAQEYGITGYPTLILFNKKNKINYGGGRTAQSIVDWLLQMTGPVFSHVEGNIEDVLKEKKINVA
FYLEYTSEDNDLYKKFNEVGDKNREIAKYFVKKNDKHNKLFCFRTDEKKVEYDEKTPLEEFVTSESFPLFGEINTENYRF
YAESPKELVWVCATYEQYNEIKEHVRLAAQELRKKTHFVLLNIPEYAEHAKASLGLTEFPGLAFQSNEGRYLLKNPKESL
LNHNAIINFFKDVEAGKIEKSLKSEPIPEDDKNAPVKIVVGNSFVDVVLKSGKDVLIEIYAPWCGHCKKLEPVYEDLGRK
LKKYDSIIVAKMDGTLNETPIKDFEWSGFPTIFFVKAGSKIPLPYEGERSLKGFVDFLNKHATNTPISIDGVPEFEDGTS
EEL

Gene-Specific Links for MAL8P1.17

General Sub-Cellular Localisation Links