ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL7P1.92 (CRMP2)

cysteine repeat modular protein 2, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during schizont
maurer's cleft during early trophozoite
during not merozoite
not cytoplasm and sporozoite surface during salivary gland sporozoite
not oocyst wall during oocyst

Who localised this protein by microscopy?

Thompson, J., Fernandez-Reyes, D., Sharling, L., Moore, S. G., Eling, W. M., Kyes, S. A., Newbold, C. I., Kafatos, F. C., Janse, C. J., Waters, A. P.
Plasmodium cysteine repeat modular proteins 1-4: complex proteins with roles throughout the malaria parasite life cycle. (2007 Jun, Cell Microbiol) PubMed / full text
   more detail about this publication

parasite plasma membrane during schizont, maurer's cleft during early trophozoite, during not merozoite, sporozoite surface and not cytoplasm during salivary gland sporozoite, not oocyst wall during oocyst
  • "PfCRMP1, PfCRMP2 and PfEMP1 are detected in an indistinguishable, diffuse, punctate pattern at the surface of P.falciparum A4 schizonts (1) and in the MCs of young trophozoite-IEs (2) but are not associated with released merozoites (3). Merged and individual images of the florescence pattern of parasites stained with the anti-peptide antibodies (red) indicated on the LHS and antiserum detecting the rhoptry protein RAP1 (green). ... PfCRMP2 peptide-specific antisera detect PfCRMP2 expression on sporozoites emerging into the mosquito haemolymph from mature P.falciparum oocysts but not on the surface of the impermeable oocyst wall (Fig.6A). At later stages, PfCRMP2 is expressed over the surface of all salivary gland sporozoites in a spiral surface pattern similar to that of the SES protein (Lacrue etal., 2006). Co-staining with the sporozoite microneme protein AMA-1 (Silvie etal., 2004), that is detected only as extracellular aggregates on non-permealilized sporozoites (Fig.6B) but throughout the cytoplasm of permealilized sporozoites (Fig.6C), confirmed that PfCRMP2 is a sporozoite surface protein with an exposed CRM domain."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: A4, 3D7, T9/96
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: PPM during schizont, MC during young trophozoite, not during merozoite, sporozoite surface and not cytoplasm during salivary gland sporozoite, not oocyst wall during oocyst
  • Other genes localised in this publication: cysteine repeat modular protein 1, rhoptry-associated protein 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_14594

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>MAL7P1.92 cysteine repeat modular protein 2
MRNSDFFFFFFVLLNCFLNIQPYVSNATSNIIKEKNTSFVKKIYDDPYIKKDVTLQLKNAKYNHINKKISKSKKNVKKKR
GISFVSLNLNKILELQDKNPIKLISNIYAKDKSKFLSTCYENNKLNDINNCNRFTISKQICDTPVGFNLNDNFLVKETGG
LSSTCLVDNKPEYWKIYNNHIIVESGEYFDLKIRNETFLLQTSIIITKDICMNKTKIESSYFTYQNNHSKIGNPILYKGE
VIGMEIKNIKVKDDVEGLFNVCSCYLDNEHHAYNKCSETNKHYMQISSIRIIKKIVHNINILTGKKLHINLQNYVTPYPI
KSAFIIKKVEHYSCNNINNKSFNEIQEHFYNNEKKLKFYNIFLYETDLQEFKEDIIFENPGMYLLCYTSNDSQSEYSAEL
STILVNGYDISKMNYLYLDLYENKLNLRNSVVLHRYNLNEKLEEIFFKKKETIQCSGEDIIYSNNITETKSYKSDDNSDD
DVIIDTIYIYNINLNAYDQILEICSKKYNEYSLIGYTTIKPYILHNYKDINHLTHFNIPPDHVRTYVVDKKSNILTFFPQ
LLNIFNQNDINDMYMSFSCYSSKNEIIITYSFDKNMTPTFFKYLKISDASSSILYITNKGVYLYVLKKKSQLLFLYDITP
EKVKKKKKIITNKKINDDYLELLLSYYLDYYDFTKCEQCLSPILMEPIYDEKQNLKHIFLITSHPLAKLLIVGLDFKIIY
KHDNNDVKNVVTTIRGFNFTSDVLKYSSFLITGISCGILKNESLDCFLIDQLNNTIIAIEYLQKQKTIILIDSFQGENKN
ELNYESINLNDFVFSQSNSYLHTPRNAIAYSFGESYVIFVNENESNELNLLFYDKNKADNNLSYITKINNTYINDGAIEN
IYKFYDHKDLINRNVLLIMKYYEGDVYFMYIPLRNIANKLELAYDYPTVIQDNGNTYTMKIKSEEIKKMNALVNFQIEVH
NVNKSKYVTIDKYDGTIEIKLSEFVGDSVNLTAKLHGFFLELNVNITFTVICSNGMKALNGICIPCPLGSYNNINEYIKN
NNIYECTLCHNNSTTKNEGSTSISQCLCLPGYELNNNDLCVPCKRGTWKTKLSNSPCIFHCYPNSYSLVQGSRSEEESKC
KCKRGFYFVSKDSINFCDNCNIGYFCPGGYKIGEKKCPKNTTNITQNNFSISSCKCDVGFEPFDSSNLNAYNFKNDPIFN
DYKDFLDDVKSSQICVPCKEGFYKNTVSEEKCKRCSDNVYTDGLQSTSISNCKKCEKGYYLQSEDSCIICPDNHYCPGAY
INDPKYAIYENQKIPCGDKSLTIPPNNLNVSHLNCLCKKGFEFIKTDDNEFDCLEVPKNYYKSHLGNKEKEPCPENSVTL
YTQTKSKVKCLCMPGYYWDLKEFKCIKCPKGHYCPGGYLKNCFNNQNLHSCKPQKKKCPLKNSTTQTKESFSQSSCLCDK
GYTINKEELRECIPCPINTYKDVISNAECTKCLTPYTTDGQIGSTKEEDCTCSGGFFFLNHCLPCSDKNTYCKGGKMIVN
NKNKTIHYGPSKCPPNTTVSFETERPYNKGFCVCQKGFKHVYTTSDFTKICAPCERGFFKTIIGDFSCESKCKPNSTSFV
GTIHETHCFCLENYYFKNGICLNCPDGAYCEGGFQKETLLYMKKNEYYLDTSKIKHIMPVPKENYALYKLKTNIYNTDWF
IVECPIKEACLYNEKCHESMTNFLCGECKKGYTNNFSKLNLCIKCSGHIMNILHMIFVSIFILLFTVIMAYLNVFTGANR
KSVHSIVIKIAVNYFSCMKIFYVMGISELYFPVTFSSHVNYILKNIKRLLKAKKNYGLYCILTNYFDLSHADAYFYGMVY
HAFRPVFLAIILTLLMFIVVEIYKYKVRNETNIKLNITDKIKELGKDKLHEEIMNELPSERALVLFRYIPIPGDSRFKRI
KNFLEDMIPMYVTLLFFIHTKTTYYMLTLLDCKALYYNDKFVEQYMSYVPSIKCDLSKSYSKFFILGLTGLIVWGIGIPL
MSYLVLYKNRKQLHSENILFKYGFLNNGFNFQFWYWESIVFLRKILVLLISTVPIFKNAKIFGTTMWLFTIISSIFLTLQ
VILQPFDSRNYHILNKLETYSMVAWTMTLIIFVFLTISNTNVTINFYVLLFLLFFNFVFIAKILISLCYSYIENLRHMKK
RIKLPFLRIFFEKMSKIAEEKDYKDPVVSLNTHDNSIQFTRKYKKKYISCSFKNNMLTTEEKNYFLDVISNFIYFGVLNL
NFSVFHSYFMEFMLRLSIIDNEMLYRKGGNGILKLIAKDPNKIDKWIKIKEREINKKTFFERHKKILNLFSKSLFVIQNN
IKSIVYKGDKHTIISDYEVLINVLKYDEDFITDFKFLYDDNAVKSGLILSDLHLSFTKIKMKDKELIKQLFSLFIAKKNI
VQFERDIQLKNKIEQLTSLYDILIKSSEKKKLTFRKNVEDAVKGDPFDYKILENELKSVNDRINNLIENYRKLKDVDYFE
GMDNIDEEKMDLNNDSEFFNNKLLELSFKELKDDITENEQNEDISKKEKEKIYDETTNDDQTK

Gene-Specific Links for MAL7P1.92

General Sub-Cellular Localisation Links