ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL7P1.91 (FEST)

exported serine/threonine protein kinase, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte plasma membrane and knob and maurer's cleft during ring and schizont and trophozoite

Who localised this protein by microscopy?

Kun, J. F., Hibbs, A. R., Saul, A., McColl, D. J., Coppel, R. L., Anders, R. F.
A putative Plasmodium falciparum exported serine/threonine protein kinase. (1997 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

erythrocyte plasma membrane and knob and maurer's cleft during ring and schizont and trophozoite
  • "By immunofluorescence microscopy, it was found in the cytoplasm of infected red cells. By immunoelectron microscopy it was associated with membranous structures in the red cell and with the red cell membrane, particularly at parasite-induced knobs."
  • Microscopy type: Light, EM
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: blast from U40232, annotation matches
  • Localisation record: membranous structures in red blood cell and red cell membrane and knobs during ring and trophozoite and schizont
  • Comment: strain information not found
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_22728

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>MAL7P1.91 exported serine/threonine protein kinase
MNNRKGKTRNFKKQIKSNMNKEKCEIINDIHSSNVEIENRDNKRNEIINYRKEKHPCSNLSNMTLNPSSYHVSNPINSHN
VNVYSSSNNIMNFRKYINDDSSNDITKQSNLSSIESHTMNLNNLYNFNNICNEINSYGFKSNPLDNTKVQNMNSSYCNQM
KYSDYYQHKPCLCHRRGILNTSNSSENQINSSDVCSLHKNDYTKISMNFPNASSSVNVDSNVYNSNITAPCVMNSNPMNY
NNGKWGSDIINMMQTTNMNNLKINDLNLNEINKINFQDSDLSICSHGTSKSKKHKSDYSTVPYNILSNNMKPNHFTSNSV
PSNNILSNNMIPNNIALNNMSSSSIISNNMASCNIPLNNMISNDGISNNIILSNLLLKSLSNKHTSNNMVSNDMLNNMPN
NMLNNMSNIMSNNMSNNMSNNMLNNMSNNMSSNMSSNMARNVSNNMSSNFISSNLSNSFISNNMSSNLFLKSLISNNFIP
DHLIPNNSNSKNIISNNVNLNNFVSNNFTSNHMEYNNRKNKNLIASSKVNTLNNENMNSLSEKLNPLILSSSHSIHNENQ
VFNNLHFSEHMQKDNEEIKNDKVIKHMQEEQIKKTPEAYLLNNYYLMFQQKLENQQSYTKNMKTDDPIKFNDIIINQQNI
CNSSMKNYNNINEEKNKMCSHENITENMNISTIKNNDDKQIVVSKRSSNVLRQMIDFPSVNDKIQNESFANTRRKAREMN
IQNDICSEAYKSETIKDRLRSRARKKGLEGVVGGRTTEANSQSLSKYDFLLNKNTIPNNTINLRNKKESKQNAQINNSKE
TCYHIIEDIDSNVNEQITKDIDMNEIKSSLKVDENMMRFLCADEKKEEMNQNHEQENILDCANKKVFNKNGSSRRKRNNE
IKNKKHEEGKDKEDKNLNDKDMEKTNVEENDIEEENITEENITEENVTEENITEENVTEENITEENITEENVTEENEDKN
SDDKNVEERNCRASAHGRRFIQTRSRYKQLYNEKHRINKNMHNKQINKMSQINNRNRNMNNMDEEKKSSTDICDHSREME
NDENEENVELDNIKELNGIINKENIENDENIKPDMKKNKEKVNVITNERNKRKREKTKCTDEKNDQGKDNTHEHMVEKKV
KLEEDSEEMERNTNNNKINYDKNNNDEKNNNTDCTNCTYCEDNIKENNIIFLNGNVENIDNDKNKLVSETVECTNDINEK
KKIGEQIACTNNDKMLYSVNVINDDFNMKNVVEFLSHNDVAIKKELNYLNIENKIHEREYILDNKKTLHIDNKKNKDIYY
NIAKSGIDENMINSNLFDNYDNKNNVRDLPRDLYSSTDGTMDIIINKKKKIWLNIGCINYMDNFVGKGSYGSVRKVLYNI
DLNNEYLKFYMDKINDVKFLKVLTHTCHMKKGLKYLVDKYDIASDSDCVSYWNDYYLELKDHVDDEKYEEITKETKNVQK
VQDEKNKDNEKSINKNTNKLNEKELVILESDLMLNNKLDNCLCCHKKRYFELAVKEIDISRKGNEFQFLREQELLCHFNC
NVIKPLSTKIGHLKDKQNYEILMHCATGDLRKLLQNLLYHRKKEYEKKKKVNKILKLIHILFGRKYHCFESLYNFECIGL
CYKKLKNMKMKINNNTIEIKNPEFDYIYENVKEYNCGLTESECKFLFFQIASGISFIQTCYQSNIVRLTDIKLQNILVFT
DSYNIYNPLKWHLCISDFGCSAMEYATYYLENSKNFMNVYKTLLNQWKYEFKNQLSSYFQGTVYTMAPEGLCYDHNGNYR
QSKYNQLIYFYEQNFGDIEKRFEELQKPPISIKHTMHNLKVLNINCNVNFTFLNNHLQKYNNEQDEKTIQESTDTIKKEK
NTLTCKKINMDNETNGTNYKNYKNKNNMSENLNIPSESSSTNNSSTNNYNNSNNTSASTQYSPFDIRCDSWSLGIILADL
AKCGVNSYEYMIMDNYREEDNLFNEKMEILNNIILKDLNVLEDDEMFYIKYIMDYYDIVSLQWGDEIIQNERIKHNVHMH
KKIDTNESKNKNNNNEINRDNAYNIYDKHKKNHADNNNNNNNIIISTNTDETNKENKKVHVKSCNKKTPHNSDMCPNNIR
SSSNTVGMVFNKNEIYLNSLKKDDEKVHVENSESFTQHYKSLILKYKKYIKNDKFIQIKNEYVHYYKIYKKYLNEENMRR
YLLLALLLMNNNISYKRCNEIQSFAKVELTIKNIGSGIFKFRNKKEKENYIKEFKMNVQNDMMNPNKDYWHSRLTNKYLA
CILKDICHDDFYNRMKKIKKSFNKYELPLNYSDEYWDLLTNLLNYVPSERLLACEVLGHDFFSEHNEKIHNIIKENNHER
YVELFKDETFCDTLLKNYKQEKKEKNYISRPFFQDLRKKLDGVYKEDQKKNIQSDYKLKLKKCSIPLEIIRNKIILNKQN
SEEKCHNNDNCYIIDTTNNSNINNNNNNNNCSNNVLRHNKKSDIFNKNIVNQINNNKTIKYIILMYEIIIKNMKKKCGMC
NDIKNCLNYKHIINKIKNLENLILNFQLSKKNIICDHKKKIKIPMLYLSNVCNNIYYFLNDYSIFEEFKNLDIFMNIHLP
FEHLSLPLCDEKTFRNKNFANFYFKPIYYYSLPYKIIHAWYTGPAHIYFNHPYIPDFIKLICLREKNVLRRKEIIFWYDE
DIVLNNILKIKDILKCSNDFLCTPYVSHLIGKQLILRKYFITKFFNDKMKLYIDN

Gene-Specific Links for MAL7P1.91

General Sub-Cellular Localisation Links