ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL7P1.86 (TFIIE)

transcription initiation factor IIE, alpha subunit, putative, a gene from Plasmodium falciparum

Compiled localisation
nucleus

Who localised this protein by microscopy?

Gopalakrishnan, A. M., Nyindodo, L. A., Ross Fergus, M., Lopez-Estrano, C.
Plasmodium falciparum: Preinitiation complex occupancy of active and inactive promoters during erythrocytic stage. (2009 Jan, Exp Parasitol) PubMed / full text
   more detail about this publication

nucleus
  • "Analysis of PfTFIIE interaction with Plasmodium promoters by ChIP assay shows that similar to PfTBP, PfTFIIE binds to erythrocytic-expressed promoters even in the absence of transcription"
  • Microscopy type: ChIP
  • Microscopy method: antibody to homologue
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from 16042788
  • Localisation record: Nucleus
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_25253

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_061500 transcription initiation factor IIE, alpha subunit, putative
  • PY00824 hypothetical protein
  • PVX_000565 hypothetical protein, conserved
  • PCHAS_061670 transcription initiation factor IIE, alpha subunit, putative
  • PKH_030100 transcription initiation factor IIE, alpha subunit, putative
  • cgd4_3810 putative transcription factor IIE alpha subunit
  • Chro.40434 transcription initiation factor iie, alpha subunit
  • CMU_018870 hypothetical protein, conserved
  • TP01_1071 hypothetical protein
  • TA16170 transcription factor TFIIE, putative
  • BBOV_IV003200 hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>MAL7P1.86 transcription initiation factor IIE, alpha subunit, putative
MENSKDIFYDKEKKFFQYLMIYISRFFMSDEEIVIFDLFINNECLYLEKDIVNNINMNEQKIRSILSKLLKDKFIIEIQK
YKNNEKGTNFQTFYCLNNYIVYVLDFRIKQMENELQKKKNESDIYICNFCNATYSQLDAQILPLDSYDAHFLCYCNNKIE
LIENDDHNDEKIYNKYTKYLNILKEHIEKLKNYFIPLYTEKFSKKNVNSNSFFFERSSDESFTNNSSEVSMTNNSSLISQ
SQLNKVVDGGKRKKDDGLTDTCSSSILKKDKKIKICMNVKSKKSVSKHVEHEDPTKNVRKNSNAKVEDFISKEKERKNKQ
NEKMAQQNVSKSNENAKQLEEEQMLEPELPFFYVKKYNKRFSLLDAQKLQQDMTQEEFENFMELQETYLDQL

Gene-Specific Links for MAL7P1.86

General Sub-Cellular Localisation Links